Rv1222 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1222

Protein Domains

Gene Information
Locus	Rv1222
Symbol
Gene Name	conserved hypothetical protein
Location	1365344 - 1365808 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:465 bp Protein:155 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	470
Related Genes	CE1179 cg1272 DIP0995 jk1379 MAP2556c Mkms_4067 ML1077 Mmcs_3993 MSMEG_5071 MT1260 MUL_4518 Mvan_4495 nfa47300
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1222
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1222 Transcript 1
MADPGSVGHVFRRAFSWLPAQFASQSDAPVGAPRQFRSTEHLSIEAIAAFVDGELRMNAH
LRAAHHLSLCAQCAAEVDDQSRARAALRDSHPIRIPSTLLGLLSEIPRCPPEGPSKGSSG
GSSQGPPDGAAAGFGDRFADGDGGNRGRQSRVRR*

Genomic Sequence

>Rv1222
ATGGCCGACCCCGGAAGCGTGGGACATGTGTTCCGGCGCGCGTTTTCCTGGCTCCCGGCG
CAGTTCGCCTCCCAGAGTGACGCGCCGGTCGGCGCGCCGCGGCAGTTCCGTTCCACCGAG
CACCTGTCAATCGAGGCCATCGCGGCTTTCGTCGACGGCGAGCTGCGGATGAACGCGCAC
TTGCGGGCCGCGCATCACCTTTCGCTGTGTGCCCAATGCGCGGCCGAAGTGGACGACCAA
AGTCGTGCCCGCGCCGCTCTGCGCGATTCCCACCCGATCCGCATCCCCAGCACGTTGCTC
GGATTACTGTCCGAGATCCCGCGTTGTCCACCTGAAGGTCCATCTAAAGGTTCGTCTGGA
GGTTCATCCCAGGGCCCGCCCGACGGGGCTGCGGCAGGCTTCGGCGACCGCTTCGCTGAC
GGCGATGGCGGGAATCGGGGCCGGCAATCGCGGGTGCGTCGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	ActivatedBy Rv0018c	active	harsharohiratruefriend	2012-10-05
	mass spectrometry R. Manganelli,R. Provvedi,S. Rodrigue,J. Beaucher,L. Gaudreau,I. Smith,R. Proveddi Sigma factors and global gene regulation in Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	ActivatedBy Rv0018c	active	harsharohiratruefriend	2012-10-05
	mass spectrometry S. Barik, K. Sureka et al. RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis. Mol. Microbiol. 2010
Interaction	InhibitedBy Rv0014c	active	harsharohiratruefriend	2012-10-05
	mass spectrometry R. Manganelli,R. Provvedi,S. Rodrigue,J. Beaucher,L. Gaudreau,I. Smith,R. Proveddi Sigma factors and global gene regulation in Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	InhibitedBy Rv0014c	active	harsharohiratruefriend	2012-10-05
	mass spectrometry S. Barik, K. Sureka et al. RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis. Mol. Microbiol. 2010
Interaction	InhibitedBy Rv0384c	active	harsharohiratruefriend	2012-10-05
	affinity purification R. Manganelli,R. Provvedi,S. Rodrigue,J. Beaucher,L. Gaudreau,I. Smith,R. Proveddi Sigma factors and global gene regulation in Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	InhibitedBy Rv0384c	active	harsharohiratruefriend	2012-10-05
	affinity purification S. Barik, K. Sureka et al. RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis. Mol. Microbiol. 2010
Interaction	Inhibits Rv1221	active	deeps8891	2012-10-05
	affinity purification V. Donà, S. Rodrigue et al. Evidence of complex transcriptional, translational, and posttranslational regulation of the extracytoplasmic function sigma factor sigmaE in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Inhibits Rv1221	active	deeps8891	2012-10-05
	affinity purification R. Manganelli,R. Provvedi,S. Rodrigue,J. Beaucher,L. Gaudreau,I. Smith,R. Proveddi Sigma factors and global gene regulation in Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	Inhibits Rv1221	active	deeps8891	2012-10-05
	affinity purification S. Barik, K. Sureka et al. RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis. Mol. Microbiol. 2010