Rv1238 - sugar-transport ATP-binding protein ABC transporter sugC

Expression: Most Significant Conditions for Rv1238

Protein Domains

Gene Information
Locus	Rv1238
Symbol	sugC
Gene Name	sugar-transport ATP-binding protein ABC transporter sugC
Location	1380684 - 1381865 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1182 bp Protein:394 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	38022
Related Genes	MAP2545c MAV_1377 Mkms_4054 ML1089 Mmcs_3980 MSMEG_5058 MT1276 Mvan_4484
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1238
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1238 Transcript 1
MAEIVLDHVNKSYPDGHTAVRDLNLTIADGEFLILVGPSGCGKTTTLNMIAGLEDISSGE
LRIAGERVNEKAPKDRDIAMVFQSYALYPHMTVRQNIAFPLTLAKMRKADIAQKVSETAK
ILDLTNLLDRKPSQLSGGQRQRVAMGRAIVRHPKAFLMDEPLSNLDAKLRVQMRGEIAQL
QRRLGTTTVYVTHDQTEAMTLGDRVVVMYGGIAQQIGTPEELYERPANLFVAGFIGSPAM
NFFPARLTAIGLTLPFGEVTLAPEVQGVIAAHPKPENVIVGVRPEHIQDAALIDAYQRIR
ALTFQVKVNLVESLGADKYLYFTTESPAVHSVQLDELAEVEGESALHENQFVARVPAESK
VAIGQSVELAFDTARLAVFDADSGANLTIPHRA*

Genomic Sequence

>Rv1238
ATGGCCGAGATTGTGTTGGACCACGTCAACAAGAGTTACCCCGACGGTCACACAGCGGTG
CGCGACCTCAACCTCACCATCGCCGACGGCGAATTTCTGATCCTGGTAGGGCCTTCCGGT
TGTGGCAAGACCACGACGCTGAATATGATTGCTGGGCTTGAAGATATCTCGTCGGGAGAA
CTGCGCATCGCCGGTGAGCGGGTAAACGAGAAGGCGCCAAAGGACCGTGACATCGCGATG
GTGTTCCAGTCGTACGCGCTTTACCCGCATATGACGGTGCGCCAGAACATCGCGTTCCCG
CTGACCCTGGCGAAGATGAGAAAGGCCGACATCGCGCAGAAGGTCTCCGAGACTGCAAAA
ATCCTTGACCTGACCAACCTTCTGGATCGCAAGCCCTCACAATTGTCGGGTGGTCAGCGA
CAGCGGGTCGCGATGGGCAGGGCAATCGTGCGCCATCCCAAAGCATTCCTGATGGACGAG
CCGCTGTCGAACTTGGACGCGAAGTTGCGGGTCCAGATGCGCGGCGAGATTGCCCAGCTG
CAGCGGAGGCTGGGTACCACCACCGTCTACGTCACCCACGACCAGACCGAGGCAATGACG
CTGGGCGATCGCGTGGTAGTGATGTACGGGGGCATCGCACAGCAGATCGGCACCCCTGAG
GAGCTTTACGAACGGCCCGCCAATCTGTTTGTCGCGGGCTTTATCGGCTCGCCGGCCATG
AATTTCTTCCCTGCCAGGCTGACCGCGATCGGACTGACCCTGCCGTTCGGTGAGGTGACG
CTGGCCCCCGAAGTCCAGGGGGTGATCGCAGCGCACCCGAAACCGGAAAACGTCATCGTA
GGCGTGCGGCCGGAGCATATCCAGGACGCAGCATTGATCGACGCGTATCAACGCATCAGG
GCGCTGACCTTCCAGGTGAAGGTCAACTTGGTCGAGTCTTTAGGCGCCGACAAATATCTG
TATTTCACTACCGAGAGCCCGGCTGTGCACTCGGTTCAGTTGGACGAGTTGGCGGAGGTA
GAGGGGGAGTCGGCGTTACACGAAAATCAGTTCGTGGCAAGGGTTCCCGCCGAGTCCAAG
GTAGCCATCGGGCAGTCGGTCGAGTTGGCTTTCGATACCGCCAGACTTGCCGTCTTCGAC
GCCGACTCCGGTGCGAACCTGACCATTCCGCACCGCGCCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Operon Rv1235	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1237	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1236	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1235	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1237	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1236	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1237	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1237	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1236	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1236	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1235	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1235	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3080c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv3080c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006