Rv1282c - oligopeptide-transport membrane protein ABC transporter oppC

Expression: Most Significant Conditions for Rv1282c

Protein Domains

Gene Information
Locus	Rv1282c
Symbol	oppC
Gene Name	oligopeptide-transport membrane protein ABC transporter oppC
Location	1435268 - 1436143 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:876 bp Protein:292 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37762
Related Genes	MAP2489 MAV_1432 Mkms_4003 ML1123 Mmcs_3929 MSMEG_4996 MT1319 MUL_4000 Mvan_4431 nfa1680
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1282c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1282c Transcript 1
MTEFASRRTLVVRRFLRNRAAVASLAALLLLFVSAYALPPLLPYSYDDLDFNALLQPPGT
KHWLGTNALGQDLLAQTLRGMQKSMLIGVCVAVISTGIAATVGAISGYFGGWRDRTLMWV
VDLLLVVPSFILIAIVTPRTKNSANIMFLVLLLAGFGWMISSRMVRGMTMSLREREFIRA
ARYMGVSSRRIIVGHVVPNVASILIIDAALNVAAAILAETGLSFLGFGIQPPDVSLGTLI
ADGTASATAFPWVFLFPASILVLILVCANLTGDGLRDALDPASRSLRRGVR*

Genomic Sequence

>Rv1282c
ATGACGGAATTCGCCTCGCGGCGCACCCTAGTGGTGCGCAGGTTCCTACGCAATCGGGCC
GCGGTGGCGTCGCTGGCGGCGCTGCTCCTGCTGTTCGTCAGCGCTTATGCGCTGCCCCCA
CTATTGCCCTACTCCTACGACGACCTTGATTTCAACGCATTGCTGCAGCCGCCGGGCACC
AAGCACTGGCTGGGCACTAACGCGCTGGGCCAAGATCTGCTGGCGCAGACGCTGCGTGGC
ATGCAGAAGTCGATGCTGATTGGTGTTTGCGTTGCGGTGATCTCGACTGGTATCGCTGCC
ACGGTTGGAGCGATCTCGGGATATTTCGGCGGCTGGCGGGACCGGACACTGATGTGGGTG
GTCGATCTGCTGCTAGTAGTGCCCAGCTTCATCCTGATCGCCATCGTTACCCCGCGAACC
AAGAACTCGGCAAACATCATGTTTCTTGTCTTGTTGTTGGCCGGCTTCGGCTGGATGATC
AGCTCTCGCATGGTGCGCGGGATGACGATGAGCTTGCGAGAACGCGAATTCATCAGGGCC
GCACGATATATGGGTGTCTCCAGCCGCCGGATCATCGTCGGCCATGTGGTGCCCAACGTC
GCATCCATCTTGATCATCGACGCCGCCCTCAATGTTGCCGCCGCCATCCTGGCCGAAACC
GGGTTGAGCTTCCTTGGTTTCGGTATTCAACCGCCGGATGTGTCGCTGGGCACCCTGATC
GCCGACGGCACCGCATCCGCGACCGCGTTCCCGTGGGTGTTCTTGTTTCCCGCCAGTATC
CTGGTGTTGATTCTGGTGTGCGCCAACCTGACCGGCGATGGCCTGCGCGACGCGCTGGAC
CCAGCCAGCAGATCCCTGCGCCGTGGTGTGCGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006