Rv1307 - ATP synthase delta chain atpH

Expression: Most Significant Conditions for Rv1307

Protein Domains

Gene Information
Locus	Rv1307
Symbol	atpH
Gene Name	ATP synthase delta chain atpH
Location	1461843 - 1463183 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1341 bp Protein:447 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34131
Related Genes	CE1311 CE1312 cg1364 cg1365 DIP1048 DIP1049 jk1338 jk1339 MAP2454c MAP2455c MAV_1523 MAV_1524 Mkms_3953 Mkms_3954 ML1141 ML1142 Mmcs_3879 Mmcs_3880 MSMEG_4939 MSMEG_4940 MT1346 MT1347 MUL_3957 MUL_3958 Mvan_4331 Mvan_4332 nfa10610 nfa10620 Rv1306
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1307
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1307 Transcript 1
MSTFIGQLFGFAVIVYLVWRFIVPLVGRLMSARQDTVRQQLADAAAAADRLAEASQAHTK
ALEDAKSEAHRVVEEARTDAERIAEQLEAQADVEAERIKMQGARQVDLIRAQLTRQLRLE
LGHESVRQARELVRNHVADQAQQSATVDRFLDQLDAMAPATADVDYPLLAKMRSASRRAL
TSLVDWFGTMAQDLDHQGLTTLAGELVSVARLLDREAVVTRYLTVPAEDATPRIRLIERL
VSGKVGAPTLEVLRTAVSKRWSANSDLIDAIEHVSRQALLELAERAGQVDEVEDQLFRFS
RILDVQPRLAILLGDCAVPAEGRVRLLRKVLERADSTVNPVVVALLSHTVELLRGQAVEE
AVLFLAEVAVARRGEIVAQVGAAAELSDAQRTRLTEVLSRIYGHPVTVQLHIDAALLGGL
SIAVGDEVIDGTLSSRLAAAEARLPD*

Genomic Sequence

>Rv1307
ATGTCGACGTTTATCGGACAGCTGTTCGGGTTCGCGGTCATCGTTTATCTGGTGTGGCGA
TTTATCGTGCCGCTCGTAGGGCGTTTGATGTCCGCACGGCAGGACACGGTGCGCCAACAG
CTGGCGGATGCGGCGGCGGCCGCCGACCGGCTGGCGGAGGCGAGTCAAGCTCACACGAAG
GCGCTGGAAGACGCCAAGTCGGAAGCGCACCGTGTTGTGGAAGAGGCCAGGACAGATGCC
GAACGCATCGCAGAACAACTAGAGGCCCAGGCCGACGTCGAGGCGGAGCGCATCAAAATG
CAGGGTGCCCGTCAGGTCGACCTCATCCGGGCACAGCTGACCCGTCAGCTTCGCCTCGAG
CTCGGTCACGAATCGGTGCGCCAGGCAAGGGAATTGGTACGCAATCACGTGGCCGATCAG
GCACAACAATCGGCCACCGTCGACCGCTTCCTGGATCAGCTCGATGCGATGGCGCCGGCT
ACGGCCGATGTCGATTACCCACTGCTGGCCAAGATGCGCTCAGCCAGCCGGAGGGCATTA
ACCAGCCTGGTGGATTGGTTCGGCACCATGGCCCAGGACCTCGACCATCAAGGTCTGACC
ACCCTCGCCGGCGAGCTGGTGTCGGTAGCAAGACTGCTGGACCGCGAGGCCGTCGTCACC
CGCTATCTCACCGTGCCAGCCGAAGATGCGACGCCCAGGATCCGGCTGATCGAACGGCTG
GTGTCCGGCAAGGTCGGCGCGCCAACGCTCGAGGTGTTGCGCACAGCCGTATCGAAGCGC
TGGTCGGCCAATTCCGATTTGATCGATGCGATCGAACACGTGTCGCGGCAGGCGCTGTTA
GAACTCGCCGAACGTGCGGGTCAGGTCGACGAGGTGGAAGACCAGTTATTCCGGTTTTCC
CGCATTCTCGACGTGCAGCCCCGGCTTGCCATCCTGTTGGGTGACTGTGCCGTTCCGGCC
GAAGGCCGAGTCCGGTTGCTGCGCAAGGTGCTTGAGCGTGCCGACAGTACCGTCAACCCG
GTCGTGGTCGCGCTGTTGTCTCACACCGTCGAGCTGCTGCGGGGTCAGGCAGTTGAGGAA
GCGGTGCTGTTCCTGGCCGAAGTTGCGGTGGCTCGCCGCGGCGAAATCGTCGCGCAGGTC
GGCGCGGCGGCCGAGCTCAGCGATGCTCAGCGCACTCGCCTCACCGAAGTGCTGAGCCGT
ATCTACGGTCACCCCGTGACCGTGCAGCTGCATATCGACGCCGCGCTGCTGGGCGGATTG
TCCATCGCGGTCGGTGACGAAGTGATCGACGGTACGCTCTCGTCTCGTCTAGCTGCGGCC
GAGGCACGACTGCCCGACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006