Rv1310 - ATP synthase beta chain atpD

Expression: Most Significant Conditions for Rv1310

Protein Domains

Gene Information
Locus	Rv1310
Symbol	atpD
Gene Name	ATP synthase beta chain atpD
Location	1465841 - 1467301 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1461 bp Protein:487 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	518
Related Genes	Acel_0653 BL0357 CE1315 cg1368 DIP1052 jk1335 MAP2451c MAV_1527 Mkms_3950 ML1145 Mmcs_3876 MSMEG_4936 MT1350 MUL_3954 Mvan_4328 nfa10650 PPA1239 SAV2881
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1310
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1310 Transcript 1
MTTTAEKTDRPGKPGSSDTSGRVVRVTGPVVDVEFPRGSIPELFNALHAEITFESLAKTL
TLEVAQHLGDNLVRTISLQPTDGLVRGVEVIDTGRSISVPVGEGVKGHVFNALGDCLDEP
GYGEKFEHWSIHRKPPAFEELEPRTEMLETGLKVVDLLTPYVRGGKIALFGGAGVGKTVL
IQEMINRIARNFGGTSVFAGVGERTREGNDLWVELAEANVLKDTALVFGQMDEPPGTRMR
VALSALTMAEWFRDEQGQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGE
LQERITSTRGRSITSMQAVYVPADDYTDPAPATTFAHLDATTELSRAVFSKGIFPAVDPL
ASSSTILDPSVVGDEHYRVAQEVIRILQRYKDLQDIIAILGIDELSEEDKQLVNRARRIE
RFLSQNMMAAEQFTGQPGSTVPVKETIEAFDRLCKGDFDHVPEQAFFLIGGLDDLAKKAE
SLGAKL*

Genomic Sequence

>Rv1310
ATGACTACCACTGCCGAAAAGACCGACCGGCCGGGAAAGCCGGGAAGCTCCGACACCAGC
GGCCGCGTGGTACGGGTCACTGGGCCCGTCGTCGACGTCGAGTTTCCTCGCGGTTCCATC
CCCGAGCTGTTCAATGCACTGCACGCTGAGATCACCTTCGAGTCGCTGGCGAAAACCCTC
ACCTTGGAGGTGGCGCAGCACCTCGGCGACAACCTGGTGCGCACCATCTCGCTGCAGCCG
ACCGACGGCTTGGTGCGCGGCGTCGAGGTGATCGACACCGGGAGGTCGATCTCGGTGCCG
GTCGGTGAGGGTGTGAAGGGCCACGTCTTCAATGCGCTGGGAGATTGCCTGGACGAGCCG
GGATATGGCGAAAAATTCGAACACTGGTCGATTCACCGCAAGCCGCCGGCGTTCGAGGAG
CTGGAGCCTCGGACCGAGATGCTCGAGACCGGTCTGAAGGTGGTCGACCTGCTGACTCCG
TATGTTCGTGGCGGCAAGATCGCACTGTTCGGCGGTGCCGGGGTGGGCAAGACGGTGCTG
ATTCAGGAGATGATCAACCGCATCGCCCGTAACTTCGGTGGTACGTCGGTGTTCGCCGGA
GTGGGCGAGCGCACCCGCGAGGGCAACGATCTGTGGGTCGAGCTTGCCGAAGCCAACGTG
CTCAAGGACACCGCGCTGGTATTCGGACAGATGGACGAGCCGCCGGGCACCCGTATGCGT
GTTGCGCTGTCTGCGCTGACGATGGCGGAGTGGTTCCGTGACGAGCAGGGTCAAGACGTA
TTGCTGTTCATCGACAACATCTTCCGGTTCACCCAGGCTGGGTCGGAAGTGTCGACGCTT
CTCGGCCGGATGCCGTCGGCCGTGGGATACCAGCCCACGCTGGCCGACGAGATGGGCGAG
CTGCAGGAGCGCATCACCTCGACGCGGGGACGCTCGATCACGTCGATGCAAGCCGTCTAC
GTGCCCGCCGACGACTACACCGACCCAGCGCCGGCGACCACGTTCGCCCACCTGGACGCC
ACGACCGAGCTATCCCGTGCGGTGTTCTCCAAGGGCATCTTCCCCGCCGTGGACCCGCTG
GCGTCCAGCTCGACCATCCTGGACCCCAGCGTTGTCGGGGATGAGCACTACCGCGTGGCC
CAGGAAGTCATCCGGATCCTGCAGCGTTACAAGGACCTTCAGGACATTATCGCGATCCTC
GGTATCGACGAGTTGTCGGAGGAGGACAAGCAGCTGGTGAACCGCGCCCGGCGTATCGAG
CGGTTCCTATCGCAGAACATGATGGCAGCCGAACAGTTCACCGGCCAGCCGGGTTCGACC
GTCCCGGTGAAGGAGACCATTGAAGCGTTCGACCGCTTGTGCAAGGGCGATTTCGATCAC
GTACCCGAACAGGCCTTCTTCTTGATCGGTGGCCTTGATGACCTGGCCAAGAAAGCCGAG
AGTCTCGGCGCCAAGCTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007