Rv1342c - conserved membrane protein

Expression: Most Significant Conditions for Rv1342c

Protein Domains

Gene Information
Locus	Rv1342c
Symbol
Gene Name	conserved membrane protein
Location	1508184 - 1508546 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:363 bp Protein:121 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28790
Related Genes	CE2399 cg2750 DIP1849 jk0501 MAP2419 MAV_1559 Mkms_3915 ML1176 Mmcs_3841 MSMEG_4900 MT1383 MUL_3905 Mvan_4284 nfa10970
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1342c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1342c Transcript 1
MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTW
IGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL
*

Genomic Sequence

>Rv1342c
ATGACCGCACCCGAAACGCCCGCGGCGCAGCACGCCGAGCCTGCCATCGCCGTCGAGAGG
ATTCGCACCGCTTTGCTCGGCTACCGGATCATGGCGTGGACGACGGGCCTCTGGCTCATC
GCACTGTGCTACGAGATCGTGGTCCGCTACGTCGTCAAGGTTGACAATCCGCCGACGTGG
ATCGGTGTGGTGCACGGCTGGGTGTACTTCACGTATCTGCTTCTGACGTTGAACCTGGCG
GTCAAGGTCCGCTGGCCGCTCGGCAAAACAGCCGGTGTTCTGCTCGCCGGCACAATTCCG
CTGCTCGGCATCGTCGTCGAGCACTTCCAGACCAAAGAGATCAAGGCCCGCTTCGGGCTT
TAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3286c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007