Rv1403c - methyltransferase

Expression: Most Significant Conditions for Rv1403c

Protein Domains

Gene Information
Locus	Rv1403c
Symbol
Gene Name	methyltransferase
Location	1579598 - 1580422 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:825 bp Protein:275 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26698
Related Genes	MAP1132c MAV_3373 ML0551 MT1447 MT1449 MUL_1798 MUL_1801 Rv1405c SAV4411 SAV4412
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1403c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1403c Transcript 1
MTVYTPTSERQAPATTHRQMWALGDYAAIAEELLAPLGPILVSTSGIRRGDRVLDVAAGS
GNVSIPAAMAGAHVTASDLTPELLRRAQARAAAAGLELGWREANAEALPFSAGEFDAVLS
TIGVMFAPRHQRTADELARVCRRGGKISTLNWTPEGFYGKLLSTIRPYRPTLPAGAPHEV
WWGSEDYVSGLFRDHVSDIRTRRGSLTVDRFGCPDECRDYFKNFYGPAINAYRSIADSPE
CVATLDAEITELCREYLCDGVMQWEYLIFTARKC*

Genomic Sequence

>Rv1403c
ATGACTGTCTACACACCCACCAGCGAGCGCCAGGCGCCGGCGACCACGCATCGGCAAATG
TGGGCATTGGGCGACTACGCCGCCATCGCCGAGGAGCTGTTGGCCCCGCTTGGCCCAATC
CTAGTCTCCACCAGCGGTATTCGCCGCGGCGATCGCGTGCTTGACGTGGCCGCGGGCTCG
GGCAACGTATCGATCCCGGCAGCCATGGCAGGTGCCCACGTCACTGCCAGCGACCTGACG
CCCGAGCTGCTGCGCCGCGCCCAGGCGCGTGCTGCGGCAGCCGGACTGGAGCTCGGCTGG
CGGGAAGCCAACGCAGAAGCCCTCCCGTTTAGCGCCGGCGAATTCGATGCGGTGCTCTCG
ACCATCGGGGTGATGTTCGCCCCGCGTCATCAGCGCACCGCCGACGAACTGGCCCGGGTC
TGCCGGCGCGGCGGCAAGATCAGCACCCTGAACTGGACCCCCGAGGGTTTCTACGGCAAA
TTGCTGTCCACCATCAGACCGTACCGGCCGACGCTGCCGGCGGGAGCGCCGCACGAGGTG
TGGTGGGGAAGCGAGGATTACGTGAGTGGCCTGTTTCGCGACCATGTGTCCGACATCCGT
ACCCGGCGAGGATCGCTGACAGTGGACCGGTTCGGTTGCCCGGACGAATGTCGCGACTAT
TTCAAGAATTTCTACGGCCCGGCGATCAACGCCTACCGCTCCATCGCCGACAGCCCCGAG
TGCGTCGCCACACTCGACGCCGAAATCACCGAACTTTGTCGCGAATACCTCTGCGACGGC
GTGATGCAGTGGGAATACCTTATCTTCACCGCCCGGAAGTGTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1405c	active	ashwinigbhat	2012-10-05
	P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1405c	active	ashwinigbhat	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1405c	active	ashwinigbhat	2012-10-05
	authors,KH. Rohde,RB. Abramovitch,DG. Russell Mycobacterium tuberculosis invasion of macrophages: linking bacterial gene expression to environmental cues. Cell Host Microbe 2007
Interaction	Regulatory Rv1405c	active	priti.priety	2012-10-05
	P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1405c	active	priti.priety	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1405c	active	priti.priety	2012-10-05
	authors,KH. Rohde,RB. Abramovitch,DG. Russell Mycobacterium tuberculosis invasion of macrophages: linking bacterial gene expression to environmental cues. Cell Host Microbe 2007
Interaction	Regulatory Rv1404	active	ashwinigbhat	2012-10-05
	qRT-PCR P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1405c	active	ashwinigbhat	2012-10-05
	P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1405c	active	ashwinigbhat	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1405c	active	ashwinigbhat	2012-10-05
	authors,KH. Rohde,RB. Abramovitch,DG. Russell Mycobacterium tuberculosis invasion of macrophages: linking bacterial gene expression to environmental cues. Cell Host Microbe 2007
Interaction	Regulatory Rv1405c	active	priti.priety	2012-10-05
	P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1405c	active	priti.priety	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1405c	active	priti.priety	2012-10-05
	authors,KH. Rohde,RB. Abramovitch,DG. Russell Mycobacterium tuberculosis invasion of macrophages: linking bacterial gene expression to environmental cues. Cell Host Microbe 2007