Rv1404 - transcriptional regulator

Expression: Most Significant Conditions for Rv1404

Protein Domains

Gene Information
Locus	Rv1404
Symbol
Gene Name	transcriptional regulator
Location	1580591 - 1581073 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:483 bp Protein:161 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	30965
Related Genes	MAP1131 MAV_3374 Mkms_2682 Mkms_2688 ML0550 Mmcs_2637 Mmcs_2643 MSMEG_3415 MSMEG_5566 MT1448 MUL_1800
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1404
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1404 Transcript 1
MMPTEYPATAEESVDVITDALLTASRLLVAISAHSIAQVDENITIPQFRTLVILSNHGPI
NLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRELLAALTKRGRDVVRQVTEHR
RTEIARIVEQMAPAERHGLVRALTAFTEAGGEPDARYEIE*

Genomic Sequence

>Rv1404
ATGATGCCAACGGAATATCCGGCGACAGCCGAGGAATCCGTGGACGTGATCACCGATGCA
TTGCTGACGGCGTCCCGGTTGCTGGTAGCCATCTCGGCCCATTCAATCGCTCAGGTCGAT
GAAAACATCACCATCCCGCAGTTCCGGACCCTGGTGATTTTGTCTAATCACGGTCCGATT
AACCTGGCTACGCTGGCGACGTTGCTGGGTGTGCAACCGTCGGCCACCGGCCGCATGGTC
GACCGGTTGGTCGGCGCCGAACTGATCGACCGGTTACCGCACCCCACCTCTCGACGGGAG
CTGCTGGCGGCGCTGACCAAGCGTGGACGAGATGTCGTCCGTCAGGTCACCGAGCACCGG
CGCACCGAGATCGCCCGCATCGTGGAACAGATGGCACCGGCGGAACGCCATGGGCTGGTG
CGTGCCCTGACGGCGTTCACCGAGGCGGGCGGTGAGCCCGACGCACGCTACGAAATCGAG
TAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3533c	active	salluamity1	2012-10-05
	Co-expression (Functional linkage) MI. Voskuil,D. Schnappinger,R. Rutherford,Y. Liu,GK. Schoolnik Regulation of the Mycobacterium tuberculosis PE/PPE genes. Tuberculosis (Edinb) 2004
Interaction	Regulatory Rv3533c	active	salluamity1	2012-10-05
	Co-expression (Functional linkage) P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3532	active	raj252000	2012-10-05
	Co-expression (Functional linkage) P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3531c	active	raj252000	2012-10-05
	Co-expression (Functional linkage) P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3531c	active	raj252000	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	PhysicalInteraction Rv1931c	active	swatigandhi19	2012-10-05
	Co-expression (Functional Linkage) G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	PhysicalInteraction Rv1931c	active	swatigandhi19	2012-10-05
	Co-expression (Functional Linkage) CC. Frota, KG. Papavinasasundaram et al. The AraC family transcriptional regulator Rv1931c plays a role in the virulence of Mycobacterium tuberculosis. Infect. Immun. 2004
Interaction	Regulatory Rv1405c	active	ashwinigbhat	2012-10-05
	qRT-PCR P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1403c	active	ashwinigbhat	2012-10-05
	qRT-PCR P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1931c	active	ashwinigbhat	2012-10-05
	Microarray analysis G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulatory Rv2711	active	ashwinigbhat	2012-10-05
	positional relative entropy method P. Prakash, S. Yellaboina et al. Computational prediction and experimental verification of novel IdeR binding sites in the upstream sequences of Mycobacterium tuberculosis open reading frames. Bioinformatics 2005
Interaction	Regulatory Rv2711	active	ashwinigbhat	2012-10-05
	positional relative entropy method S. Ranjan, S. Yellaboina et al. IdeR in mycobacteria: from target recognition to physiological function. Crit. Rev. Microbiol. 2006
Interaction	Regulatory Rv0195	active	aparna.vchalam	2012-10-05
	Co-expression (Functional linkage) P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	Transcription Rv0193c	active	sourish10	2012-10-05
	Protein-Protein P. Golby, J. Nunez et al. Characterization of two in vivo-expressed methyltransferases of the Mycobacterium tuberculosis complex: antigenicity and genetic regulation. Microbiology (Reading, Engl.) 2008
Interaction	RegulatedBy Rv1931c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1931c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1404	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1404	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1931c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1931c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv1404	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1404	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006