Rv1440 - protein-export membrane protein translocase subunit secG

Expression: Most Significant Conditions for Rv1440

Protein Domains

Gene Information
Locus	Rv1440
Symbol	secG
Gene Name	protein-export membrane protein translocase subunit secG
Location	1617837 - 1618070 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:234 bp Protein:78 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	679
Related Genes	Acel_1121 BL0709 CE1702 cg1786 DIP1307 jk0997 MAP1167 MAV_3338 Mkms_2453 ML0577 Mmcs_2407 MSMEG_3087 MT1485 MUL_1835 Mvan_2706 nfa35840 PPA0819 SAV6299
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1440
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1440 Transcript 1
MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVT
GIWLVSIIGVALLIKYR*

Genomic Sequence

>Rv1440
ATGGAATTGGCCCTGCAGATCACGCTGATCGTCACGAGCGTGCTGGTGGTGTTGTTAGTA
CTGCTGCACCGGGCCAAGGGTGGCGGGCTATCGACACTGTTCGGCGGTGGTGTGCAGTCA
AGCCTGTCCGGCTCGACGGTGGTGGAGAAGAACCTGGACCGGTTGACGCTGTTCGTTACC
GGCATCTGGCTGGTGTCCATCATCGGCGTGGCGTTGCTCATCAAATACCGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0379	active	shahanup86	2012-10-05
	authors,F. Duong Binding, activation and dissociation of the dimeric SecA ATPase at the dimeric SecYEG translocase. EMBO J. 2003
Interaction	PhysicalInteraction Rv0638	active	shahanup86	2012-10-05
	authors,F. Duong Binding, activation and dissociation of the dimeric SecA ATPase at the dimeric SecYEG translocase. EMBO J. 2003
Interaction	PhysicalInteraction Rv3240c	active	shahanup86	2012-10-05
	authors,F. Duong Binding, activation and dissociation of the dimeric SecA ATPase at the dimeric SecYEG translocase. EMBO J. 2003
Interaction	PhysicalInteraction Rv0732	active	shahanup86	2012-10-05
	authors,F. Duong Binding, activation and dissociation of the dimeric SecA ATPase at the dimeric SecYEG translocase. EMBO J. 2003
Interaction	PhysicalInteraction Rv0732	active	jgalag	2012-10-05
	Structural analysis JM. Hou, NG. D'Lima et al. ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv0732	active	jgalag	2012-10-05
	Structural analysis authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv0379	active	manish.srcp	2012-10-05
	authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004