Rv1457c - antibiotic-transport membrane ABC transporter

Expression: Most Significant Conditions for Rv1457c

Protein Domains

Gene Information
Locus	Rv1457c
Symbol
Gene Name	antibiotic-transport membrane ABC transporter
Location	1642537 - 1643322 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:786 bp Protein:262 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29761
Related Genes	CE1690 cg1768 DIP1299 jk0988 MAP1183c MAV_3322 Mkms_2477 ML0589 Mmcs_2432 MSMEG_3118 MT1504 MUL_1858 Mvan_2729 nfa35660 PPA1558 SAV6321
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1457c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1457c Transcript 1
MTQTNRPAFPAGTFSPDPRPNAVPLMLAAQFSLELKLLLRNGEQLLLTMFIPITLLVGLT
LLPMGSFGHNRAATFVPVIMALAVISTAFTGQAIAVAFDRRYGALKRLGATPLPVWGIIA
GKSLAVVAVVFLQAIILGAIGFALGWRPALTALTLGAGIIALGTAGFAALGLLLGGTLRA
EIVLAVANLMWFVFAGFGALTLESNVIPTAFKWVARVTPSGALTEALSQAMTVSVDWFGI
VVLAVWGALAALAALRWFRFT*

Genomic Sequence

>Rv1457c
GTGACCCAAACCAATCGCCCCGCTTTTCCCGCGGGCACCTTCAGCCCGGACCCCCGCCCC
AACGCCGTCCCCCTGATGCTTGCCGCACAGTTCAGCCTGGAATTGAAGCTGCTGTTACGC
AACGGCGAGCAACTGCTGTTGACCATGTTCATCCCGATCACCCTGCTGGTCGGGCTGACT
TTGCTGCCGATGGGCTCGTTCGGCCACAACCGCGCCGCCACCTTTGTTCCGGTCATCATG
GCGCTTGCGGTGATCTCCACCGCATTCACCGGGCAAGCCATCGCGGTCGCGTTCGATCGC
CGCTACGGCGCCCTCAAACGACTCGGTGCTACCCCGCTGCCGGTTTGGGGGATCATCGCC
GGCAAGTCGCTGGCAGTGGTTGCCGTGGTGTTCTTGCAGGCCATCATCTTGGGCGCCATC
GGCTTTGCGCTCGGCTGGCGGCCGGCGCTGACGGCCCTGACATTGGGCGCCGGGATCATC
GCGCTGGGTACCGCGGGCTTTGCGGCGCTCGGCCTGCTACTCGGCGGCACCTTGCGAGCC
GAGATCGTTCTCGCCGTCGCCAACCTGATGTGGTTCGTATTCGCCGGTTTCGGTGCGCTG
ACCTTGGAGTCGAACGTGATCCCGACGGCGTTCAAATGGGTGGCTCGGGTTACCCCGTCG
GGCGCGCTCACCGAGGCGCTGTCGCAGGCCATGACCGTGTCGGTGGACTGGTTCGGGATC
GTCGTCCTAGCGGTGTGGGGCGCGCTGGCCGCACTGGCCGCACTGCGCTGGTTCCGGTTC
ACCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1459c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1456c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1459c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1456c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1459c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1456c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1459c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1456c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1459c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1456c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1459c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1456c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,D. Kaur,ME. Guerin,H. Skovierová,PJ. Brennan,M. Jackson Chapter 2: Biogenesis of the cell wall and other glycoconjugates of Mycobacterium tuberculosis. Adv. Appl. Microbiol. 2009
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003