Rv1458c - antibiotic-transport ATP-binding protein ABC transporter

Expression: Most Significant Conditions for Rv1458c

Protein Domains

Gene Information
Locus	Rv1458c
Symbol
Gene Name	antibiotic-transport ATP-binding protein ABC transporter
Location	1643319 - 1644260 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:942 bp Protein:314 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37353
Related Genes	CE1689 cg1767 DIP1298 jk0987 MAP1184c MAV_3321 Mkms_2478 ML0590 Mmcs_2433 MSMEG_3119 MT1499 MT1505 MUL_1859 Mvan_2730 nfa35650 Rv1452c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1458c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1458c Transcript 1
MNRAPDTPEVVLRLRGVCKRYGSITAVSNLDLDVHDAEVMALLGPNGAGKTTTVEMCEGF
VRPDAGSIEVLGLDPITDNARLRARIGVMLQGGGGYPAARAGEMLDLVASYAANPLDPHW
LLDTLGLTEAARTTYRRLSGGQQQRLALACALVGRPQLVFLDEPTAGMDAHARVLVWELI
DALRRDGVTVVLTTHHLKEAEELADRLVIIDHGVTVAAGTPAELMRSGAKDQLRFTAPPR
LDLSLLASALPEGYQATELTPGEYLVEGPVDPQVLATVTAWCAQIDVLATDMRVEQRSLE
DVFLDLTGRKLRQ*

Genomic Sequence

>Rv1458c
GTGAACCGCGCCCCAGACACCCCCGAGGTGGTACTGCGGCTTCGCGGGGTATGTAAGCGA
TACGGGTCAATAACCGCCGTTTCCAACCTCGATCTCGACGTGCATGACGCCGAAGTGATG
GCGCTGCTGGGCCCCAACGGCGCGGGCAAGACCACGACCGTCGAGATGTGCGAGGGCTTC
GTCCGCCCGGACGCCGGCAGCATTGAGGTACTTGGACTGGACCCGATCACCGACAACGCA
CGCCTGCGCGCACGCATCGGCGTGATGTTGCAGGGTGGCGGCGGCTACCCGGCGGCACGC
GCCGGCGAAATGCTGGATCTGGTCGCGTCCTACGCCGCCAACCCGCTGGACCCGCACTGG
CTACTGGACACCTTGGGTCTCACCGAGGCCGCCCGCACCACCTATCGACGGCTCTCCGGC
GGGCAGCAGCAACGACTCGCGCTGGCCTGCGCGCTGGTCGGGCGTCCCCAACTGGTGTTC
CTCGACGAGCCCACCGCGGGCATGGATGCCCATGCCCGGGTACTGGTGTGGGAGTTGATC
GACGCGCTGCGCCGCGATGGCGTGACCGTGGTGCTGACCACGCATCATCTCAAGGAGGCC
GAGGAACTCGCCGATCGGTTGGTGATCATCGACCACGGGGTGACGGTGGCCGCAGGCACA
CCGGCAGAACTGATGCGCAGCGGCGCCAAAGACCAGTTGCGGTTCACCGCGCCGCCGCGG
CTCGACCTGTCGCTGCTGGCCTCGGCACTGCCCGAGGGCTACCAGGCCACCGAGCTGACC
CCGGGCGAGTACCTGGTCGAAGGTCCGGTTGACCCGCAGGTGCTGGCGACGGTCACCGCG
TGGTGCGCACAAATCGACGTGCTAGCCACCGACATGCGGGTCGAGCAACGCAGCCTCGAA
GACGTGTTCCTGGATCTCACCGGCAGGAAGTTGCGGCAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1459c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1456c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1459c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1456c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1459c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1456c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1459c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1456c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1459c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1456c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1459c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1456c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,D. Kaur,ME. Guerin,H. Skovierová,PJ. Brennan,M. Jackson Chapter 2: Biogenesis of the cell wall and other glycoconjugates of Mycobacterium tuberculosis. Adv. Appl. Microbiol. 2009
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009