Rv1555 - fumarate reductase membrane anchor subunit frdD

Expression: Most Significant Conditions for Rv1555

Protein Domains

Gene Information
Locus	Rv1555
Symbol	frdD
Gene Name	fumarate reductase membrane anchor subunit frdD
Location	1760552 - 1760929 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:378 bp Protein:126 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8992
Related Genes	MT1606
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1555
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1555 Transcript 1
MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLA
MVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGW
MLLTM*

Genomic Sequence

>Rv1555
ATGACTCCCTCGACATCGGATGCCAGGTCGCGCCGACGCTCGGCGGAGCCCTTCCTGTGG
CTGCTGTTCAGCGCCGGGGGCATGGTCACCGCCCTGGTTGCGCCCGTCCTGCTGTTGCTG
TTCGGACTCGCGTTTCCGCTCGGGTGGCTCGACGCGCCCGACCACGGGCACCTACTGGCG
ATGGTGCGCAACCCGATCACCAAGCTTGTTGTGCTGGTCCTGGTGGTACTGGCCCTGTTC
CATGCGGCGCACCGGTTCCGGTTCGTGCTCGACCATGGGCTGCAACTGGGCCGGTTCGAC
CGAGTGATCGCCCTGTGGTGTTACGGCATGGCCGTGTTGGGCTCGGCGACGGCGGGTTGG
ATGTTGCTCACTATGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv1571	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Bacterial artificial chromosome fingerprint arrays for the differentiation of transcriptomic differences in mycobacteria. J. Microbiol. Methods 2008
Interaction	Signaling Rv1571	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv1553	active	ashwinigbhat	2012-10-05
	qPCR AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv1552	active	ashwinigbhat	2012-10-05
	qPCR AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Term	EC:1.3.99.1 Succinate dehydrogenase. - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011