Rv1561 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1561

Protein Domains

Gene Information
Locus	Rv1561
Symbol
Gene Name	conserved hypothetical protein
Location	1764979 - 1765383 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:405 bp Protein:135 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8993
Related Genes	MT1612
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1561
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1561 Transcript 1
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLER
LVNGLPSLNVDDAIDFRAAAGIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFD
VIARITNLQAASFR*

Genomic Sequence

>Rv1561
ATGATCCTCATCGACACATCGGCCTGGGTGGAGTACTTCCGTGCCACCGGATCAATCGCC
GCTGTCGAAGTACGCCGGCTGCTGTCCGAAGAAGCAGCGCGAATCGCTATGTGTGAGCCC
ATTGCGATGGAAATCTTGAGTGGCGCGCTCGACGACAACACCCACACGACGCTAGAGCGG
CTCGTGAATGGCTTGCCGTCGTTGAACGTTGATGACGCGATTGACTTTCGTGCTGCCGCG
GGTATCTATCGCGCCGCCCGGCGCGCCGGCGAAACGGTTCGAAGCATCAACGACTGCCTC
ATAGCGGCGCTCGCGATCCGCCACGGTGCGCGTATCGTCCACCGTGACGCCGACTTTGAT
GTGATTGCCCGGATTACCAACCTGCAGGCCGCATCGTTTCGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv1560	active	vizhi.gurusamy	2012-10-05
	Functional linkage (Gene neighborhood) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv1560	active	vizhi.gurusamy	2012-10-05
	Functional linkage (Gene neighborhood) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1560	active	vizhi.gurusamy	2012-10-05
	Functional linkage (Gene neighborhood) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	VapC-mt11	active	jlew	2012-03-07
	Expression resulted in growth arrest in E coli. Expressed 23 VapC toxins in EC lacking TA modules. 4 inhibited growth. authors,JD. Sharp,JW. Cruz,S. Raman,M. Inouye,RN. Husson,NA. Woychik Growth and translation inhibition through sequence specific RNA binding by a mycobacterium tuberculosis VAPC toxin. The Journal of biological chemistry 2012
Symbol	VapC11	active	jlew	2012-03-07
	Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY22G8.03 (124 aa).
Other	stop:1765383	active	rslayden	2012-03-05
	MTCY22G8.03 (124 aa).
Other	start:1764979	active	rslayden	2012-03-05
	MTCY22G8.03 (124 aa).
Other	strand:+	active	rslayden	2012-03-05
	Rv1114
Other	stop:1765383	active	rslayden	2012-03-05
	Rv1114
Other	start:1764979	active	rslayden	2012-03-05
	Rv1114
Other	strand:+	active	rslayden	2012-03-05
	MTCY39.07c (132 aa), FASTA scores: (37.0% identity in 127 aa overlap); and O06566
Other	stop:1765383	active	rslayden	2012-03-05
	MTCY39.07c (132 aa), FASTA scores: (37.0% identity in 127 aa overlap); and O06566
Other	start:1764979	active	rslayden	2012-03-05
	MTCY39.07c (132 aa), FASTA scores: (37.0% identity in 127 aa overlap); and O06566
Other	strand:+	active	rslayden	2012-03-05
	Rv2010
Other	stop:1765383	active	rslayden	2012-03-05
	Rv2010
Other	start:1764979	active	rslayden	2012-03-05
	Rv2010
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to others from Mycobacterium tuberculosis e.g. Q10847
Other	stop:1765383	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to others from Mycobacterium tuberculosis e.g. Q10847
Other	start:1764979	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to others from Mycobacterium tuberculosis e.g. Q10847