Rv1571 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1571

Protein Domains

Gene Information
Locus	Rv1571
Symbol
Gene Name	conserved hypothetical protein
Location	1778539 - 1779048 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:510 bp Protein:170 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	2760
Related Genes	MAP1277 MAV_3203 Mkms_3135 Mmcs_3075 MSMEG_3191 MT1622 MUL_1562 Mvan_2791
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1571
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1571 Transcript 1
MVHSIELVFDSDTEAAIRRIWAGLAAAGIPSQAPASRPHVSLAVAERIAPEVDEPLGAVA
RRLPLDCVIGAPVLFGRANVVFTRLVVPTSELLALHAEVHRLCGPHLAPAPMANSLPGQW
TAHVTLARRVGGHQLGRALRIAGRPSRIDGRFAGLRRWDGNTRAEYLLG*

Genomic Sequence

>Rv1571
ATGGTGCATTCGATCGAGCTGGTCTTCGACAGCGATACCGAGGCGGCGATCCGGCGCATC
TGGGCGGGGTTGGCCGCCGCCGGCATACCCAGCCAGGCGCCGGCCAGCCGTCCGCACGTG
TCGCTGGCGGTGGCCGAACGGATCGCCCCGGAGGTCGATGAGCCGCTGGGTGCGGTTGCC
CGTCGGCTGCCGCTGGACTGCGTGATCGGCGCGCCGGTGCTGTTCGGGCGGGCCAATGTC
GTGTTCACCCGGCTGGTGGTGCCGACCAGCGAGCTTTTGGCCCTGCATGCCGAGGTGCAC
CGGCTCTGCGGCCCGCACCTGGCGCCCGCGCCGATGGCCAACAGCCTGCCCGGTCAGTGG
ACCGCCCATGTCACCCTGGCCCGACGGGTCGGTGGTCACCAATTGGGGCGGGCGCTGCGC
ATTGCGGGACGGCCGTCGCGGATTGACGGTCGGTTCGCCGGCTTGCGCCGCTGGGACGGC
AACACGCGTGCCGAGTACCTGCTGGGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv1555	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Bacterial artificial chromosome fingerprint arrays for the differentiation of transcriptomic differences in mycobacteria. J. Microbiol. Methods 2008
Interaction	Signaling Rv1554	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Bacterial artificial chromosome fingerprint arrays for the differentiation of transcriptomic differences in mycobacteria. J. Microbiol. Methods 2008
Interaction	Signaling Rv1553	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Bacterial artificial chromosome fingerprint arrays for the differentiation of transcriptomic differences in mycobacteria. J. Microbiol. Methods 2008
Interaction	Signaling Rv2241	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Bacterial artificial chromosome fingerprint arrays for the differentiation of transcriptomic differences in mycobacteria. J. Microbiol. Methods 2008
Interaction	Signaling Rv3825c	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Bacterial artificial chromosome fingerprint arrays for the differentiation of transcriptomic differences in mycobacteria. J. Microbiol. Methods 2008
Interaction	Signaling Rv1555	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	Signaling Rv1554	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	Signaling Rv1553	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	Signaling Rv2241	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	Signaling Rv3825c	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008