Rv1623c - membrane cytochrome D ubiquinol oxidase subunit I cydA

Expression: Most Significant Conditions for Rv1623c

Protein Domains

Gene Information
Locus	Rv1623c
Symbol	cydA
Gene Name	membrane cytochrome D ubiquinol oxidase subunit I cydA
Location	1824430 - 1825887 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1458 bp Protein:486 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28294
Related Genes	Acel_0600 CE1253 cg1301 DIP1898 MAP1316c MAV_3164 Mkms_3095 Mmcs_3036 MSMEG_3233 MT1659 Mvan_2830 nfa5850 PPA0176 SAV4260
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1623c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1623c Transcript 1
MNVVDISRWQFGITTVYHFIFVPLTIGLAPLIAVMQTLWVVTDNPAWYRLTKFFGKLFLI
NFAIGVATGIVQEFQFGMNWSEYSRFVGDVFGAPLAMEGLAAFFFESTFIGLWIFGWNRL
PRLVHLACIWIVAIAVNVSAFFIIAANSFMQHPVGAHYNPTTGRAELSSIVVLLTNNTAQ
AAFTHTVSGALLTAGTFVAAVSAWWLVRSSTTHADSDTQAMYRPATILGCWVALAATAGL
LFTGDHQGKLMFQQQPMKMASAESLCDTQTDPNFSVLTVGRQNNCDSLTRVIEVPYVLPF
LAEGRISGVTLQGIRDLQQEYQQRFGPNDYRPNLFVTYWSFRMMIGLMAIPVLFALIALW
LTRGGQIPNQRWFSWLALLTMPAPFLANSAGWVFTEMGRQPWVVVPNPTGDQLVRLTVKA
GVSDHSATVVATSLLMFTLVYAVLAVIWCWLLKRYIVEGPLEHDAEPAAHGAPRDDEVAP
LSFAY*

Genomic Sequence

>Rv1623c
ATGAATGTCGTCGACATTTCGCGGTGGCAGTTCGGTATCACCACCGTCTATCACTTCATT
TTCGTACCGCTGACCATCGGCCTGGCCCCGCTGATCGCGGTCATGCAAACGCTGTGGGTC
GTCACCGATAACCCCGCCTGGTATCGCCTCACCAAATTCTTCGGCAAATTGTTCCTGATC
AACTTTGCCATCGGCGTGGCGACCGGAATCGTGCAGGAATTTCAGTTCGGCATGAACTGG
AGCGAGTACTCCCGATTCGTCGGCGATGTCTTCGGCGCCCCGCTGGCCATGGAGGGCCTG
GCGGCCTTCTTCTTCGAATCCACCTTCATCGGGTTGTGGATCTTCGGCTGGAACAGGCTG
CCCCGGCTGGTGCATCTGGCCTGCATCTGGATCGTCGCAATCGCGGTCAACGTGTCCGCG
TTCTTCATCATCGCGGCAAACTCCTTCATGCAGCATCCGGTCGGCGCGCACTACAACCCG
ACCACCGGGCGTGCCGAGTTGAGCAGCATCGTCGTGCTGCTGACCAACAACACCGCACAG
GCGGCGTTTACCCACACTGTCAGCGGTGCGCTGCTGACCGCCGGGACCTTCGTCGCCGCG
GTGAGCGCCTGGTGGCTGGTCCGTTCGAGCACCACGCACGCCGACTCAGATACCCAAGCC
ATGTATCGTCCCGCGACCATCCTGGGGTGTTGGGTTGCGTTGGCCGCCACGGCCGGGTTG
TTGTTCACCGGCGACCACCAAGGCAAGCTGATGTTCCAGCAGCAGCCGATGAAGATGGCG
TCGGCCGAATCGTTGTGCGATACCCAGACAGATCCAAACTTCTCTGTCCTGACGGTCGGC
CGGCAAAACAACTGCGACAGCCTCACCCGTGTCATCGAAGTGCCCTATGTGTTGCCGTTC
CTCGCCGAGGGCCGGATCAGCGGTGTGACGTTGCAGGGTATCCGCGATCTGCAGCAGGAA
TACCAGCAGCGCTTCGGACCAAACGACTACCGGCCCAACCTCTTCGTCACCTACTGGTCA
TTTCGCATGATGATCGGGTTGATGGCGATCCCGGTGCTGTTCGCACTGATTGCGCTCTGG
CTCACCCGTGGCGGCCAGATCCCCAATCAACGCTGGTTCTCCTGGCTGGCGCTGCTAACC
ATGCCCGCCCCGTTCCTGGCCAACAGCGCCGGATGGGTGTTCACCGAGATGGGGCGCCAG
CCCTGGGTCGTCGTCCCTAACCCGACCGGTGATCAGCTGGTTCGACTCACCGTCAAAGCA
GGCGTCTCGGATCACTCCGCCACCGTGGTCGCCACGTCTTTGCTGATGTTCACCTTGGTC
TACGCGGTACTTGCGGTCATCTGGTGCTGGCTGCTCAAGCGTTACATCGTCGAAGGCCCC
CTGGAACACGACGCGGAACCGGCTGCGCACGGGGCACCCCGCGACGACGAGGTAGCACCA
TTGTCGTTTGCTTACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1621c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1622c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1621c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1622c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1621c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1622c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1621c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1622c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1622c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1622c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1622c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1622c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1621c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1621c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1621c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1621c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009