Rv1660 - chalcone synthase pks10

Expression: Most Significant Conditions for Rv1660

Protein Domains

Gene Information
Locus	Rv1660
Symbol	pks10
Gene Name	chalcone synthase pks10
Location	1874160 - 1875221 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1062 bp Protein:354 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29480
Related Genes	MAP1369 MAP1372 MAV_3105 MAV_3110 Mkms_1075 Mmcs_1059 MSMEG_0808 MT1698 MT1705 MUL_1656 Mvan_1196 Rv1665 SAV7131
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1660
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1660 Transcript 1
MSVIAGVFGALPPYRYSQRELTDSFVSIPDFEGYEDIVRQLHASAKVNSRHLVLPLEKYP
KLTDFGEANKIFIEKAVDLGVQALAGALDESGLRPEDLDVLITATVTGLAVPSLDARIAG
RLGLRADVRRVPLFGLGCVAGAAGVARLHDYLRGAPDGVAALVSVELCSLTYPGYKPTLP
GLVGSALFADGAAAVVAAGVKRAQDIGADGPDILDSRSHLYPDSLRTMGYDVGSAGFELV
LSRDLAAVVEQYLGNDVTTFLASHGLSTTDVGAWVTHPGGPKIINAITETLDLSPQALEL
TWRSLGEIGNLSSASVLHVLRDTIAKPPPSGSPGLMIAMGPGFCSELVLLRWH*

Genomic Sequence

>Rv1660
GTGAGCGTCATCGCAGGTGTGTTCGGCGCGTTGCCGCCGTATCGCTATTCACAACGCGAG
CTCACCGACTCGTTTGTCAGCATCCCGGATTTCGAGGGCTACGAAGACATCGTTCGCCAG
CTGCACGCCAGCGCCAAAGTCAACAGCCGCCACCTGGTCTTGCCGCTGGAGAAATACCCG
AAGCTGACCGACTTCGGCGAGGCGAACAAGATTTTCATCGAAAAAGCCGTGGACTTGGGC
GTGCAAGCCCTGGCGGGGGCACTCGACGAGTCCGGTCTGCGACCCGAGGATCTCGACGTG
TTGATCACCGCCACGGTCACCGGACTGGCGGTGCCGTCGCTGGATGCCCGGATCGCCGGG
CGGCTGGGGCTGCGCGCCGATGTCCGGAGGGTGCCGCTGTTCGGGCTGGGCTGCGTGGCC
GGGGCGGCCGGGGTCGCCCGGCTGCACGACTACCTGCGCGGGGCCCCGGACGGCGTTGCC
GCGTTGGTCTCGGTCGAGCTGTGTTCACTCACGTATCCGGGATACAAGCCGACGCTGCCG
GGCCTTGTCGGCAGTGCGTTGTTTGCTGACGGCGCCGCGGCGGTGGTGGCCGCAGGTGTG
AAGCGCGCCCAGGACATCGGCGCCGACGGGCCGGACATCCTGGATTCGCGCAGCCATCTG
TACCCCGACTCGCTGCGCACCATGGGATACGACGTCGGCTCGGCCGGGTTCGAGCTCGTC
CTATCACGGGACTTGGCGGCCGTGGTCGAGCAGTATCTGGGCAATGACGTCACCACCTTC
CTGGCTTCGCACGGCCTGAGCACCACCGACGTCGGCGCCTGGGTCACCCATCCCGGGGGA
CCCAAGATCATCAACGCCATCACCGAGACCCTCGACCTGTCGCCGCAGGCTCTCGAGCTG
ACGTGGCGCTCGTTGGGCGAAATCGGGAATCTGTCGTCAGCGTCGGTGCTGCATGTGCTG
CGTGACACCATCGCCAAACCGCCCCCCAGCGGAAGTCCCGGGTTGATGATCGCCATGGGC
CCAGGCTTCTGTTCCGAACTCGTGTTGCTGCGCTGGCACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1664	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1664	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	Operon Rv1661	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	Operon Rv1661	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Operon Rv1661	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	Operon Rv1661	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv0735	active	ashwinigbhat	2012-10-05
	E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Interaction	Regulatory Rv0735	active	ashwinigbhat	2012-10-05
	authors,SK. Jain,SM. Hernandez-Abanto,QJ. Cheng,P. Singh,LH. Ly,LG. Klinkenberg,NE. Morrison,PJ. Converse,E. Nuermberger,J. Grosset,DN. McMurray,PC. Karakousis,G. Lamichhane,WR. Bishai Accelerated detection of Mycobacterium tuberculosis genes essential for bacterial survival in guinea pigs, compared with mice. J. Infect. Dis. 2007
Interaction	Regulatory Rv0735	active	priti.priety	2012-10-05
	E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Interaction	Regulatory Rv0735	active	priti.priety	2012-10-05
	authors,SK. Jain,SM. Hernandez-Abanto,QJ. Cheng,P. Singh,LH. Ly,LG. Klinkenberg,NE. Morrison,PJ. Converse,E. Nuermberger,J. Grosset,DN. McMurray,PC. Karakousis,G. Lamichhane,WR. Bishai Accelerated detection of Mycobacterium tuberculosis genes essential for bacterial survival in guinea pigs, compared with mice. J. Infect. Dis. 2007
Interaction	Operon Rv1661	active	harsharohiratruefriend	2012-10-05
	operon TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
Interaction	RegulatedBy Rv0735	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008