Rv1720c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1720c

Protein Domains

Gene Information
Locus	Rv1720c
Symbol
Gene Name	conserved hypothetical protein
Location	1947030 - 1947419 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:390 bp Protein:130 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28602
Related Genes	MT1761
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1720c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1720c Transcript 1
MIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGL
VVVVNFLSLPVRRWPLKPFTQRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHG
HNAEIELVA*

Genomic Sequence

>Rv1720c
GTGATCGTGTTGGACGCCTCGGCGGCCGTCGAGCTCATGCTCACGACGCCGGCGGGTGCG
GCGGTCGCCCGGCGCTTGCGGGGCGAAACCGTGCACGCCCCTGCACATTTCGATGTCGAG
GTGATCGGGGCGATACGTCAAGCGGTCGTGCGTCAGCTGATCAGCGATCATGAAGGACTC
GTCGTGGTTGTCAACTTCCTTAGCCTGCCCGTTCGGCGTTGGCCGTTAAAGCCATTCACC
CAGCGTGCCTACCAACTTCGGTCCACTCATACCGTGGCCGATGGAGCCTACGTCGCCCTC
GCCGAGGGCCTCGGCGTACCGCTTATCACTTGCGACGGGCGACTTGCCCAATCCCATGGC
CATAATGCGGAGATCGAGCTTGTCGCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv1721c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv1721c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Symbol	VapC12	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY25D10.28C (137 aa).
Other	stop:1947419	active	rslayden	2012-03-05
	MTCY25D10.28C (137 aa).
Other	start:1947030	active	rslayden	2012-03-05
	MTCY25D10.28C (137 aa).
Other	strand:+	active	rslayden	2012-03-05
	Rv0549c
Other	stop:1947419	active	rslayden	2012-03-05
	Rv0549c
Other	start:1947030	active	rslayden	2012-03-05
	Rv0549c
Other	strand:+	active	rslayden	2012-03-05
	MTCY10D7.14C (129 aa) and O06415
Other	stop:1947419	active	rslayden	2012-03-05
	MTCY10D7.14C (129 aa) and O06415
Other	start:1947030	active	rslayden	2012-03-05
	MTCY10D7.14C (129 aa) and O06415
Other	strand:+	active	rslayden	2012-03-05
	Rv0960
Other	stop:1947419	active	rslayden	2012-03-05
	Rv0960
Other	start:1947030	active	rslayden	2012-03-05
	Rv0960
Other	strand:+	active	rslayden	2012-03-05
	MTV030.08 (133 aa), FASTA scores: E(): 1.5e-10, (39.1% identity in 128 aa overlap); P71550
Other	stop:1947419	active	rslayden	2012-03-05
	MTV030.08 (133 aa), FASTA scores: E(): 1.5e-10, (39.1% identity in 128 aa overlap); P71550
Other	start:1947030	active	rslayden	2012-03-05
	MTV030.08 (133 aa), FASTA scores: E(): 1.5e-10, (39.1% identity in 128 aa overlap); P71550
Other	strand:+	active	rslayden	2012-03-05
	Rv0065
Other	stop:1947419	active	rslayden	2012-03-05
	Rv0065
Other	start:1947030	active	rslayden	2012-03-05
	Rv0065
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. O53610
Other	stop:1947419	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. O53610
Other	start:1947030	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to other Mycobacterium tuberculosis hypothetical proteins e.g. O53610