Rv1810 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1810

Protein Domains

Gene Information
Locus	Rv1810
Symbol
Gene Name	conserved hypothetical protein
Location	2052933 - 2053289 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:357 bp Protein:119 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11717
Related Genes	MAP1520 MAP1523 MAV_2904 MAV_2907 MAV_2908 MT1854 MT1858 MUL_3070 Rv1804c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1810
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1810 Transcript 1
MQLQRTMGQCRPMRMLVALLLSAATMIGLAAPGKADPTGDDAAFLAALDQAGITYADPGH
AITAAKAMCGLCANGVTGLQLVADLRDYNPGLTMDSAAKFAAIASGAYCPEHLEHHPS*

Genomic Sequence

>Rv1810
ATGCAATTACAACGCACGATGGGACAATGCAGACCTATGAGAATGCTAGTAGCGCTCCTG
CTGAGCGCCGCCACCATGATCGGCCTAGCCGCACCCGGGAAAGCCGATCCAACAGGCGAC
GATGCCGCCTTCCTTGCCGCGTTGGACCAGGCCGGCATCACCTACGCTGACCCAGGCCAC
GCCATAACGGCCGCCAAGGCGATGTGTGGGCTGTGTGCTAACGGCGTAACAGGTCTACAG
CTGGTCGCGGACCTGCGGGACTACAATCCCGGGCTGACCATGGACAGCGCGGCCAAGTTC
GCTGCCATCGCATCAGGCGCGTACTGCCCCGAACACCTGGAACATCACCCGAGTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008