Rv1826 - glycine cleavage system H protein gcvH

Expression: Most Significant Conditions for Rv1826

Protein Domains

Gene Information
Locus	Rv1826
Symbol	gcvH
Gene Name	glycine cleavage system H protein gcvH
Location	2071952 - 2072356 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:405 bp Protein:135 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33006
Related Genes	Acel_1227 BL1221 jk0211 MAP1539 MAV_2889 Mkms_2889 ML2077 Mmcs_2845 MSMEG_3648 MT1874 MUL_3045 Mvan_3136 nfa24850 PPA0743 PPA1083 SAV2774 SCO5471
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1826
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1826 Transcript 1
MSDIPSDLHYTAEHEWIRRSGDDTVRVGITDYAQSALGDVVFVQLPVIGTAVTAGETFGE
VESTKSVSDLYAPISGKVSEVNSDLDGTPQLVNSDPYGAGWLLDIQVDSSDVAALESALT
TLLDAEAYRGTLTE*

Genomic Sequence

>Rv1826
GTGAGCGATATCCCGTCCGATCTGCACTACACCGCCGAACACGAGTGGATTCGCCGCAGT
GGCGACGACACCGTCCGGGTGGGGATCACCGACTATGCACAGTCGGCGCTTGGCGACGTC
GTTTTCGTTCAGCTACCCGTTATCGGCACCGCGGTCACCGCCGGCGAGACCTTCGGCGAA
GTGGAATCGACGAAATCTGTGTCGGATCTCTATGCGCCCATTTCGGGTAAGGTGTCTGAG
GTCAACAGCGATCTGGACGGCACTCCGCAATTGGTGAATTCCGACCCCTACGGAGCCGGC
TGGCTGCTGGACATCCAGGTCGACAGCTCGGATGTCGCTGCCCTGGAGTCAGCTTTGACG
ACACTGCTCGACGCTGAGGCCTACCGCGGCACACTGACCGAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv2211c	active	harsharohiratruefriend	2012-10-05
	authors,K. Okamura-Ikeda,Y. Ohmura,K. Fujiwara,Y. Motokawa Cloning and nucleotide sequence of the gcv operon encoding the Escherichia coli glycine-cleavage system. Eur. J. Biochem. 1993
Interaction	Transcription Rv1825	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1824	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1825	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1824	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1825	active	sourish10	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1825	active	sourish10	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1824	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1824	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3575c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3575c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006