Rv1904 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1904

Protein Domains

Gene Information
Locus	Rv1904
Symbol
Gene Name	conserved hypothetical protein
Location	2150954 - 2151385 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:432 bp Protein:144 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20701
Related Genes	MAP2742 MAV_3518 MT1955 MT2716 MUL_2925 MUL_3282 nfa24330 Rv2638 SAV2058
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1904
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1904 Transcript 1
MRTVAIGPGAGPSSTRPSSQPSDLHSGLRAVTECTGSAVVVHVGGDIDASNEVAWQRLVS
KSAAIAIAPGPFVIDIRDLDFMGSCAYAVLAQESVRCRRRGVNMRLVSNQPIVARTIAAC
GLRRLIPLYATVETALAPPPSAH*

Genomic Sequence

>Rv1904
ATGCGCACTGTCGCGATTGGACCAGGTGCCGGTCCTTCGAGCACACGGCCGAGTTCGCAA
CCCAGTGACCTGCATAGCGGCCTACGCGCGGTTACCGAGTGCACCGGCTCAGCGGTGGTC
GTTCATGTGGGCGGCGACATCGACGCCAGTAACGAGGTCGCTTGGCAGCGTCTGGTGAGC
AAGAGCGCCGCTATCGCCATCGCGCCGGGTCCGTTCGTCATCGACATTCGGGACCTCGAC
TTCATGGGATCATGTGCATACGCTGTGTTGGCCCAGGAGTCGGTGCGGTGTCGCCGGCGC
GGGGTGAATATGCGGTTGGTGAGTAACCAGCCGATCGTGGCCCGCACCATTGCCGCGTGC
GGACTGCGGCGACTAATTCCGCTGTATGCAACGGTCGAGACCGCACTGGCGCCGCCTCCC
AGCGCGCATTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Signaling Rv1743	active	ashwinigbhat	2012-10-05
	Kinetic studies AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Signaling Rv1364c	active	kaveri.verma	2012-10-05
	yeast two-hybrid system(functional linkage) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Signaling Rv3286c	active	kaveri.verma	2012-10-05
	yeast two-hybrid system(functional linkage) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Signaling Rv3287c	active	kaveri.verma	2012-10-05
	yeast two-hybrid system(functional linkage) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv3287c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	PhysicalInteraction Rv1904	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	PhysicalInteraction Rv1904	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1364c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1365c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null