Rv1953 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1953

Protein Domains

Gene Information
Locus	Rv1953
Symbol
Gene Name	conserved hypothetical protein
Location	2200938 - 2201249 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:312 bp Protein:104 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	5461
Related Genes	BL0298 MT2003 Mvan_1710 nfa19600
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1953
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1953 Transcript 1
MTYVLDTNVVSALRVPGRHPAVAAWADSVQVAEQFVVAITLAEIERGVIAKERTDPTQSE
HLRRWFDDKVLRIFVFARRGTNLIMQPLAGHIGYSLYSGISWF*

Genomic Sequence

>Rv1953
GTGACCTACGTCCTGGACACCAACGTGGTGTCCGCTTTGCGCGTGCCGGGACGCCACCCC
GCCGTGGCGGCGTGGGCGGACTCGGTGCAAGTCGCCGAACAGTTCGTTGTGGCGATAACG
CTGGCCGAGATTGAGCGAGGCGTGATCGCCAAGGAACGCACCGACCCGACCCAGAGTGAG
CACCTACGGCGCTGGTTCGACGACAAGGTGCTGCGCATATTCGTGTTCGCCCGCCGGGGC
ACAAACCTCATCATGCAGCCCCTAGCTGGGCATATAGGTTACAGCCTATATTCTGGTATA
AGCTGGTTTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv1952	active	prabhakarsmail	2012-10-05
	Coexpression(Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv1952	active	akankshajain.21	2012-10-05
	Coexpression(Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv1952	active	prabhakarsmail	2012-10-05
	Coexpression(Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv1952	active	akankshajain.21	2012-10-05
	Coexpression(Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapC	active	jlew	2012-03-07
	authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapC14	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to O33827 PLASMID STABILITY-LIKE PROTEIN from Thiobacillus ferrooxidans (143aa), FASTA scores: opt: 170, E(): 3.5e-06, (45.3% identity in 75 aa overlap).
Other	stop:2201249	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to O33827 PLASMID STABILITY-LIKE PROTEIN from Thiobacillus ferrooxidans (143aa), FASTA scores: opt: 170, E(): 3.5e-06, (45.3% identity in 75 aa overlap).
Other	start:2200938	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to O33827 PLASMID STABILITY-LIKE PROTEIN from Thiobacillus ferrooxidans (143aa), FASTA scores: opt: 170, E(): 3.5e-06, (45.3% identity in 75 aa overlap).