Rv1955 - hypothetical protein

Expression: Most Significant Conditions for Rv1955

Protein Domains

Gene Information
Locus	Rv1955
Symbol
Gene Name	hypothetical protein
Location	2201584 - 2202096 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:513 bp Protein:171 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9042
Related Genes	MT2004
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1955
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1955 Transcript 1
MPSGWVSHRLGGSPKCISALSLPSGTVGAPSKPDNDATRGRTRPTVPPPDPAAMGTWKFF
RASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNH
FRVLFFRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI*

Genomic Sequence

>Rv1955
GTGCCGTCGGGATGGGTGTCGCACCGTCTCGGCGGGTCGCCCAAGTGCATAAGTGCTTTG
TCGCTGCCCTCCGGTACCGTCGGAGCCCCGTCCAAGCCGGACAACGACGCCACTCGAGGC
AGGACAAGACCAACTGTGCCGCCCCCTGATCCAGCCGCCATGGGTACCTGGAAGTTCTTC
CGGGCATCTGTGGATGGCCGGCCGGTATTCAAGAAGGAGTTCGACAAGCTTCCTGATCAG
GCCCGGGCCGCGCTGATCGTGCTAATGCAGCGGTATCTCGTCGGCGACCTCGCCGCAGGG
AGCATCAAACCGATTCGTGGCGACATTCTGGAGTTGCGATGGCATGAGGCGAACAACCAC
TTCCGGGTACTGTTCTTCCGCTGGGGCCAGCATCCCGTAGCGCTGACAGCGTTCTACAAG
AACCAGCAGAAGACTCCCAAGACGAAGATCGAGACGGCCCTGGACCGGCAGAAAATCTGG
AAAAGAGCCTTCGGCGACACCCCACCGATCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3662c	active	jgalag	2012-10-05
	Co-expression (Functional linkage) authors,AS. Fivian-Hughes,EO. Davis Analyzing the regulatory role of the HigA antitoxin within Mycobacterium tuberculosis. J. Bacteriol. 2010
Interaction	InhibitedBy Rv1956	active	prabhakarsmail	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1956	active	akankshajain.21	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1956	active	prabhakarsmail	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1956	active	akankshajain.21	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Symbol	higB	active	jlew	2012-03-07
	In Ecoli, HigB expression blocks growth but not if HigA and Rv1957 are also present; HigA or Rv1957 alone does not rescue. authors,P. Bordes,AM. Cirinesi,R. Ummels,A. Sala,S. Sakr,W. Bitter,P. Genevaux SecB-like chaperone controls a toxin-antitoxin stress-responsive system in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2011
Symbol	higB	active	jlew	2012-03-07
	higB-higA-Rv1957 could be deleted, but not higA alone authors,AS. Fivian-Hughes,EO. Davis Analyzing the regulatory role of the HigA antitoxin within Mycobacterium tuberculosis. J. Bacteriol. 2010
Other	strand:+	active	rslayden	2012-03-05
	Hypothetical unknown protein, start overlaps another ORF, Rv1954c (MTCY09F9.10).
Other	stop:2202091	active	rslayden	2012-03-05
	Hypothetical unknown protein, start overlaps another ORF, Rv1954c (MTCY09F9.10).
Other	start:2201741	active	rslayden	2012-03-05
	Hypothetical unknown protein, start overlaps another ORF, Rv1954c (MTCY09F9.10).