Rv1963c - tetR-family transcriptional repressor mce3R

Expression: Most Significant Conditions for Rv1963c

Protein Domains

Gene Information
Locus	Rv1963c
Symbol	mce3R
Gene Name	tetR-family transcriptional repressor mce3R
Location	2205582 - 2206802 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1221 bp Protein:407 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36135
Related Genes	Mkms_1561 Mmcs_1538 MT2014 MUL_2880 Mvan_3985 Mvan_3994 SAV6104
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1963c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1963c Transcript 1
MASVAQPVRRRPKDRKKQILDQAVGLFIERGFHSVKLEDIAEAAGVTARALYRHYDNKQA
LLAEAIRTGQDQYQSARRLTEGETEPTPRPLNADLEDLIAAAVASRALTVLWQREARYLN
EDDRTAVRRRINAIVAGMRDSVLLEVPDLSPQHSELRAWAVSSTLTSLGRHSLSLPGEEL
KKLLYQACMAAARTPPVCELPPLPAGDAARDEADVLFSRYETLLAAGARLFRAQGYPAVN
TSEIGKGAGIAGPGLYRSFSSKQAILDALIRRLDEWRCLECIRALRANQQAAQRLRGLVQ
GHVRISLDAPDLVAVSVTELSHASVEVRDGYLRNQGDREAVWIDLIGKLVPATSVAQGRL
LVAAAISFIEDVARTWHLTRYAGVADEISGLALAILTSGAGNLLRA*

Genomic Sequence

>Rv1963c
ATGGCATCCGTCGCCCAACCCGTTAGGCGCCGCCCAAAGGACCGGAAGAAGCAGATTTTG
GATCAGGCCGTTGGACTGTTCATCGAACGTGGCTTCCATTCGGTCAAATTGGAGGACATT
GCCGAGGCGGCCGGGGTGACCGCGCGCGCGTTGTATCGCCACTACGACAACAAGCAGGCG
TTGCTCGCCGAAGCGATCCGAACCGGCCAGGATCAGTACCAGAGCGCGCGTCGTCTCACC
GAGGGCGAGACGGAGCCGACGCCGCGGCCGTTGAACGCCGATCTGGAAGACCTGATCGCC
GCGGCGGTCGCCTCTCGGGCGTTGACGGTGCTGTGGCAGCGCGAGGCCCGCTACCTCAAC
GAGGACGACCGCACGGCGGTCCGGCGCCGCATCAACGCGATCGTCGCCGGCATGCGTGAC
AGCGTGCTGCTGGAGGTGCCCGATCTGAGTCCACAGCATTCGGAGTTGCGGGCGTGGGCG
GTGTCCAGCACTTTGACCAGCCTGGGCCGGCACAGCCTAAGCCTGCCGGGCGAGGAACTG
AAAAAGCTTCTCTACCAGGCGTGTATGGCCGCGGCAAGGACGCCTCCCGTCTGCGAATTG
CCGCCACTGCCGGCCGGTGATGCCGCACGCGACGAGGCCGACGTGCTGTTCTCCCGCTAC
GAGACCCTGCTGGCCGCGGGCGCGCGGCTGTTCCGTGCGCAGGGCTATCCGGCCGTCAAC
ACCAGCGAAATCGGCAAGGGAGCCGGCATCGCGGGCCCGGGGCTGTACCGTTCGTTTTCT
TCCAAACAGGCCATCCTGGACGCGCTCATCCGCCGCCTCGACGAGTGGCGCTGCCTGGAG
TGCATCCGAGCGCTACGAGCGAATCAGCAAGCGGCACAACGGTTGCGCGGCCTTGTCCAA
GGGCACGTTCGGATCAGCTTGGACGCTCCGGATCTGGTGGCAGTGTCGGTCACCGAACTG
TCGCACGCCTCTGTCGAAGTACGCGACGGCTACCTGCGAAATCAGGGCGACCGCGAGGCC
GTGTGGATCGACCTCATCGGCAAGCTGGTACCCGCGACCAGTGTCGCCCAGGGGCGACTG
CTGGTCGCGGCGGCGATTAGCTTCATCGAAGACGTCGCTCGCACCTGGCATCTCACGCGC
TACGCCGGAGTCGCCGACGAGATCAGTGGCCTGGCGCTGGCGATCCTGACCAGCGGGGCA
GGTAACCTCTTGCGCGCATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1973	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1973	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1973	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1973	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1972	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1972	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1972	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1972	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1970	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1970	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1970	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1970	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1969	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1969	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1967	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1967	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1967	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1967	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1940	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1938	active	swatigandhi19	2012-10-05
	Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1937	active	swatigandhi19	2012-10-05
	Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1936	active	swatigandhi19	2012-10-05
	Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1935c	active	harsharohiratruefriend	2012-10-05
	MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1934c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1934c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1933c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1933c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1930c	active	swatigandhi19	2012-10-05
	Co-expression (Functional Linkage) authors,PM. Quigley,K. Korotkov,F. Baneyx,WG. Hol The 1.6-A crystal structure of the class of chaperones represented by Escherichia coli Hsp31 reveals a putative catalytic triad. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv1930c	active	swatigandhi19	2012-10-05
	Co-expression (Functional Linkage) authors,S. Mostowy,J. Inwald,S. Gordon,C. Martin,R. Warren,K. Kremer,D. Cousins,MA. Behr Revisiting the evolution of Mycobacterium bovis. J. Bacteriol. 2005
Interaction	Regulatory Rv1930c	active	swatigandhi19	2012-10-05
	Co-expression (Functional Linkage) MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Inhibition Rv0046c	active	shahanup86	2012-10-05
	MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulates Rv1416	active	yamir.moreno	2012-10-05
	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv0046c	active	yamir.moreno	2012-10-05
	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1323	active	yamir.moreno	2012-10-05
	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv0234c	active	yamir.moreno	2012-10-05
	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1936	active	yamir.moreno	2012-10-05
	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1975	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1973	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1972	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1971	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1970	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1967	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1965	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1964	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1943c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1942c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1942c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1941	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1940	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1940	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1939	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1938	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1938	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1938	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1937	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1935c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1935c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1934c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1933c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1933c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1931c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Interaction	Regulates Rv1930c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008