Rv1991c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1991c

Protein Domains

Gene Information
Locus	Rv1991c
Symbol
Gene Name	conserved hypothetical protein
Location	2234305 - 2234649 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:345 bp Protein:115 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9051
Related Genes	MT2046
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1991c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1991c Transcript 1
MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGN
VFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL*

Genomic Sequence

>Rv1991c
GTGGTGATTAGTCGTGCCGAGATCTACTGGGCTGACCTCGGGCCGCCATCAGGCAGTCAG
CCGGCGAAGCGCCGCCCGGTGCTCGTAATCCAGTCAGATCCGTACAACGCAAGTCGCCTT
GCCACTGTGATCGCAGCGGTGATCACGTCCAATACGGCGCTGGCGGCAATGCCCGGCAAC
GTGTTCTTGCCCGCGACCACAACGCGACTGCCACGTGACTCGGTCGTCAACGTCACGGCG
ATTGTCACGCTCAACAAGACTGACCTCACCGACCGAGTTGGGGAGGTGCCAGCGAGCTTG
ATGCACGAGGTTGACCGAGGACTTCGTCGCGTACTGGACCTTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Symbol	mazF-mt3	active	jlew	2012-03-07
	mRNA levels elevated in Mtb in limited O2.. No growth when mazF-mt1 expressed in Ecoli but restored when mazE-mt1 was co-induced. mazF-mt1 could also be partially neutralized by vapB-mt24 or vapB-mt25. Growth inhibition by mazF-mt3; normal growth if mazE-mt1, mazE-mt3, vapB-mt24 or vapB-mt25 were co-expressed. Each pair shows interaction by pull-down. authors,L. Zhu,JD. Sharp,H. Kobayashi,NA. Woychik,M. Inouye Noncognate Mycobacterium tuberculosis toxin-antitoxins can physically and functionally interact. J. Biol. Chem. 2010
Symbol	MazF6	active	jlew	2012-03-07
	Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	mazF-mt3	active	jlew	2012-03-07
	Caused cell growth arrest when induced in Ecoli. authors,L. Zhu,Y. Zhang,JS. Teh,J. Zhang,N. Connell,H. Rubin,M. Inouye Characterization of mRNA interferases from Mycobacterium tuberculosis. J. Biol. Chem. 2006
Other	strand:+	active	rslayden	2012-03-05
	YDCE PROTEIN from Bacillus subtilis (116 aa), FASTA scores: opt: 227, E(): 6.9e-09, (37.4% identity in 115 aa overlap). Also similar to Mycobacterium tuberculosis Rv2801c, and Rv0659c.
Other	stop:2234649	active	rslayden	2012-03-05
	YDCE PROTEIN from Bacillus subtilis (116 aa), FASTA scores: opt: 227, E(): 6.9e-09, (37.4% identity in 115 aa overlap). Also similar to Mycobacterium tuberculosis Rv2801c, and Rv0659c.
Other	start:2234305	active	rslayden	2012-03-05
	YDCE PROTEIN from Bacillus subtilis (116 aa), FASTA scores: opt: 227, E(): 6.9e-09, (37.4% identity in 115 aa overlap). Also similar to Mycobacterium tuberculosis Rv2801c, and Rv0659c.
Other	strand:+	active	rslayden	2012-03-05
	PEMK_ECOLI pemk protein (133 aa), FASTA scores: opt: 113, E(): 0.043, (29.2% identity in 113 aa overlap); and P96622
Other	stop:2234649	active	rslayden	2012-03-05
	PEMK_ECOLI pemk protein (133 aa), FASTA scores: opt: 113, E(): 0.043, (29.2% identity in 113 aa overlap); and P96622
Other	start:2234305	active	rslayden	2012-03-05
	PEMK_ECOLI pemk protein (133 aa), FASTA scores: opt: 113, E(): 0.043, (29.2% identity in 113 aa overlap); and P96622
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to P13976
Other	stop:2234649	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to P13976
Other	start:2234305	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to P13976