Rv2021c - transcriptional regulator

Expression: Most Significant Conditions for Rv2021c

Protein Domains

Gene Information
Locus	Rv2021c
Symbol
Gene Name	transcriptional regulator
Location	2266805 - 2267110 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:306 bp Protein:102 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11414
Related Genes	MT2077
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2021c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2021c Transcript 1
MAMTLRDMDAVRPVNREAVDRHKARMRDEVRAFRLRELRAAQSLTQVQVAALAHIRQSRV
SSIENGDIGSAQVNTLRKYVSALGGELDITVRLGDETFTLA*

Genomic Sequence

>Rv2021c
ATGGCGATGACACTACGGGACATGGACGCCGTACGTCCCGTTAACCGGGAGGCGGTGGAC
CGGCACAAGGCACGAATGCGCGATGAAGTGCGGGCATTCCGGCTCCGGGAGCTGCGCGCG
GCTCAGTCACTCACCCAGGTCCAGGTGGCTGCGCTGGCGCACATCCGGCAGAGCCGGGTA
TCCAGCATCGAGAACGGCGACATCGGCTCCGCACAGGTCAACACACTGCGCAAATACGTG
TCCGCTCTTGGCGGAGAACTGGATATCACCGTCCGCCTGGGAGATGAGACATTCACCCTG
GCATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2590	active	hibeeluck	2012-10-05
	Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	InhibitedBy Rv3133c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulates Rv3875	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3874	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3538	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3537	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3418c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3417c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2590	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0551c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0440	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009