Rv2057c - 50S ribosomal protein L33

Expression: Most Significant Conditions for Rv2057c

Protein Domains

Gene Information
Locus	Rv2057c
Symbol	rpmG1
Gene Name	50S ribosomal protein L33
Location	2314661 - 2314825 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:165 bp Protein:55 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32677
Related Genes	BL1560 CE0942 cg0990 DIP0850 jk1536 MAP3769c MAV_4876 Mkms_4816 Mmcs_4730 MSMEG_6067 MUL_4832 Mvan_5490 nfa49760 PPA2160 SAV4643
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2057c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2057c Transcript 1
MARTDIRPIVKLRSTAGTGYTYTTRKNRRNDPDRLILRKYDPILRRHVDFREER*

Genomic Sequence

>Rv2057c
ATGGCGCGCACCGACATCCGGCCGATTGTGAAGCTGCGTTCCACGGCGGGCACCGGCTAC
ACCTACACCACCCGCAAGAACCGCCGTAATGACCCCGACCGTCTCATCTTGCGCAAATAC
GACCCGATCCTGCGGCGTCACGTGGACTTTCGCGAGGAACGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2359	active	devensrcp	2012-10-05
	Physical interaction A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv2359	active	devensrcp	2012-10-05
	Physical interaction authors,DJ. Beste,E. Laing,B. Bonde,C. Avignone-Rossa,ME. Bushell,JJ. McFadden Transcriptomic analysis identifies growth rate modulation as a component of the adaptation of mycobacteria to survival inside the macrophage. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv0105c	active	raj252000	2012-10-05
	operon (Functional Linkage) authors,BA. Maguire,DG. Wild Mutations in the rpmBG operon of Escherichia coli that affect ribosome assembly. J. Bacteriol. 1997
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008