Rv2115c

Gene Information
Locus	Rv2115c
Symbol
Gene Name	ATPase
Location	2374461 - 2376290 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1830 bp Protein:610 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32623
Related Genes	Acel_1184 BL1794 CE1626 cg1691 DIP1248 jk0948 MAV_2400 Mkms_3194 ML1316 Mmcs_3132 MSMEG_3902 MT2159 MT2175 MUL_2337 Mvan_3458 nfa31800 Rv2098c SAV6677
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2115c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2115c Transcript 1
MGESERSEAFGIPRDSPLSSGDAAELEQLRREAAVLREQLENAVGSHAPTRSARDIHQLE
ARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGR
KMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHA
DEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPKAEVED
LVLEEVPDVSYADIGGLSRQIEQIRDAVELPFLHKELYREYSLRPPKGVLLYGPPGCGKT
LIAKAVANSLAKKMAEVRGDDAHEAKSYFLNIKGPELLNKFVGETERHIRLIFQRAREKA
SEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVPQLLSEIDGVEGLENVIVIGASNREDM
IDPAILRPGRLDVKIKIERPDAEAAQDIYSKYLTEFLPVHADDLAEFDGDRSACIKAMIE
KVVDRMYAEIDDNRFLEVTYANGDKEVMYFKDFNSGAMIQNVVDRAKKNAIKSVLETGQP
GLRIQHLLDSIVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSSASRAID
TESNLGQYL*

Genomic Sequence

>Rv2115c
ATGGGTGAGTCAGAGCGTTCTGAGGCATTCGGCATCCCCCGGGATAGCCCGCTGTCCAGT
GGTGATGCCGCCGAATTAGAACAGCTGCGGCGCGAGGCTGCGGTCCTGCGCGAGCAACTT
GAGAACGCCGTCGGATCACATGCCCCGACGCGCTCTGCCCGCGATATACATCAACTCGAA
GCCCGTATCGACTCACTTGCTGCCCGCAATTCCAAATTAATGGAAACTCTTAAAGAAGCC
CGTCAACAACTGCTGGCGCTGCGCGAGGAAGTTGACCGGCTGGGGCAGCCGCCCAGTGGC
TACGGCGTCCTGCTGGCCACGCACGACGACGACACGGTCGATGTGTTCACATCGGGTCGC
AAGATGCGCCTGACGTGCTCACCGAATATTGACGCTGCATCGCTGAAGAAGGGGCAGACG
GTCCGGCTCAACGAGGCCCTGACCGTCGTGGAGGCCGGCACATTCGAGGCGGTCGGCGAG
ATATCCACCTTGCGCGAGATCCTGGCCGACGGTCATCGGGCTCTGGTCGTCGGCCACGCC
GACGAGGAACGCGTTGTTTGGCTGGCTGATCCCCTGATCGCCGAGGACCTGCCAGACGGC
CTCCCTGAGGCCCTCAACGATGACACCCGGCCGCGCAAGCTGCGCCCCGGCGACTCGCTG
CTGGTCGACACCAAAGCCGGCTATGCCTTCGAACGCATCCCCAAAGCCGAGGTAGAAGAC
CTGGTGCTGGAAGAGGTGCCGGACGTCAGCTACGCCGACATCGGCGGTCTGAGCCGCCAG
ATCGAGCAGATCCGCGACGCCGTGGAGCTGCCGTTCCTGCACAAGGAGTTGTACCGGGAG
TACTCGCTGCGCCCGCCCAAGGGTGTGTTGCTCTATGGCCCACCCGGCTGTGGTAAGACG
TTGATCGCCAAGGCTGTGGCCAACTCGTTGGCCAAGAAAATGGCCGAGGTCCGCGGCGAC
GATGCCCACGAGGCGAAGTCGTACTTCCTCAACATCAAGGGCCCCGAGCTGCTGAACAAA
TTCGTCGGGGAAACGGAACGCCACATCCGGCTGATCTTCCAACGGGCCCGCGAGAAGGCG
TCGGAAGGCACTCCGGTGATCGTGTTTTTCGACGAGATGGACTCGATCTTTCGCACCCGT
GGCACCGGCGTTTCCTCGGACGTCGAGACCACGGTGGTCCCGCAGCTGCTCAGCGAGATC
GACGGGGTGGAGGGACTCGAGAATGTCATCGTGATCGGCGCCTCCAACCGAGAGGACATG
ATCGACCCTGCCATCCTGCGGCCCGGGCGCCTCGACGTGAAGATCAAGATCGAGCGGCCT
GATGCCGAAGCGGCGCAGGACATCTACTCGAAGTACCTGACCGAGTTCTTGCCGGTGCAC
GCCGACGATCTCGCCGAGTTCGACGGTGACCGTTCGGCCTGCATCAAGGCGATGATCGAG
AAGGTTGTCGACCGGATGTATGCCGAGATCGACGACAACCGGTTCCTGGAGGTCACCTAT
GCCAACGGCGACAAGGAAGTCATGTACTTCAAGGACTTCAACTCCGGGGCGATGATCCAG
AACGTCGTCGACCGAGCCAAGAAGAACGCCATCAAATCGGTGCTGGAGACCGGCCAACCG
GGACTGCGTATACAGCATCTGCTCGATTCGATCGTCGACGAGTTCGCCGAGAACGAGGAT
TTGCCCAACACCACCAACCCCGATGACTGGGCGCGGATCTCGGGCAAGAAGGGGGAGCGG
ATCGTCTACATCCGCACCCTGGTCACCGGAAAGAGTTCGTCGGCCAGCAGGGCTATTGAT
ACCGAGTCCAACCTCGGCCAGTACCTGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2115c	active	jgalag	2012-10-05
	Structural Analysis T. Wang,H. Li,G. Lin,C. Tang,D. Li,C. Nathan,KH. Darwin,H. Li Structural insights on the Mycobacterium tuberculosis proteasomal ATPase Mpa. Structure 2009
Interaction	PhysicalInteraction Rv2115c	active	jgalag	2012-10-05
	Structural Analysis T. Wang,H. Li,G. Lin,C. Tang,D. Li,C. Nathan,KH. Darwin,H. Li Structural insights on the Mycobacterium tuberculosis proteasomal ATPase Mpa. Structure 2009
Interaction	Regulatory Rv2097c	active	sourish10	2012-10-05
	Structural Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2111c	active	sourish10	2012-10-05
	Structural Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2097c	active	sourish10	2012-10-05
	Structural Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2111c	active	sourish10	2012-10-05
	Structural Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2097c	active	sourish10	2012-10-05
	Structural Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2111c	active	sourish10	2012-10-05
	Structural Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2097c	active	sourish10	2012-10-05
	Structural Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2111c	active	sourish10	2012-10-05
	Structural Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2097c	active	sourish10	2012-10-05
	Spectrophotometric Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2111c	active	sourish10	2012-10-05
	Spectrophotometric Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2097c	active	sourish10	2012-10-05
	Spectrophotometric Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2111c	active	sourish10	2012-10-05
	Spectrophotometric Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2097c	active	sourish10	2012-10-05
	Spectrophotometric Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2111c	active	sourish10	2012-10-05
	Spectrophotometric Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2097c	active	sourish10	2012-10-05
	Spectrophotometric Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2111c	active	sourish10	2012-10-05
	Spectrophotometric Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2097c	active	ahal4789	2012-10-05
	Structural Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2111c	active	ahal4789	2012-10-05
	Structural Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2097c	active	ahal4789	2012-10-05
	Structural Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2111c	active	ahal4789	2012-10-05
	Structural Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2097c	active	ahal4789	2012-10-05
	Structural Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2111c	active	ahal4789	2012-10-05
	Structural Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2097c	active	ahal4789	2012-10-05
	Structural Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2111c	active	ahal4789	2012-10-05
	Structural Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2097c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2111c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2097c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2111c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2097c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2111c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2097c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2111c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009

Rv2115c - ATPase