Rv2145c - hypothetical protein wag31

Expression: Most Significant Conditions for Rv2145c

Protein Domains

Gene Information
Locus	Rv2145c
Symbol	wag31
Gene Name	hypothetical protein wag31
Location	2404616 - 2405398 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:783 bp Protein:261 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31676
Related Genes	Acel_1027 BL0121 CE2045 cg2361 DIP1590 jk0758 MAP1889c MAV_2345 Mkms_3310 ML0922 Mmcs_3248 MSMEG_4217 MT2204 MUL_3493 Mvan_3515 nfa17740 PPA0765 SAV6129
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2145c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2145c Transcript 1
MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQEL
AAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNT
AKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKA
DALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSA
APVDSNADAGGFDQFNRGKN*

Genomic Sequence

>Rv2145c
ATGCCGCTTACACCTGCCGACGTCCACAATGTGGCGTTCAGTAAGCCGCCTATCGGCAAA
CGTGGGTACAACGAAGATGAGGTCGACGCCTTCCTCGACCTGGTGGAAAACGAGCTGACC
CGCCTGATCGAAGAGAACTCCGATCTGCGTCAGAGGATCAACGAGCTGGATCAAGAGCTC
GCCGCGGGCGGCGGTGCCGGCGTTACGCCGCAGGCCACCCAGGCAATCCCGGCGTATGAG
CCCGAACCGGGCAAGCCGGCGCCGGCGGCGGTCTCGGCGGGGATGAACGAGGAACAGGCC
CTGAAGGCGGCGCGAGTGCTGAGTCTGGCCCAAGACACCGCCGACCGGCTTACAAACACC
GCCAAAGCCGAGTCGGACAAGATGCTGGCCGATGCCCGTGCCAATGCGGAGCAGATCCTC
GGTGAGGCCCGACACACCGCCGACGCCACGGTCGCCGAGGCCCGCCAGCGTGCCGATGCC
ATGCTGGCCGATGCCCAATCCCGATCCGAGGCCCAGTTGCGCCAGGCGCAGGAGAAGGCC
GATGCCTTACAGGCCGATGCGGAACGCAAGCACTCCGAGATCATGGGAACCATCAACCAG
CAGCGCGCGGTGCTTGAAGGCCGCCTCGAGCAGCTGCGTACCTTCGAACGTGAGTACCGC
ACCAGGCTCAAGACCTACCTGGAATCGCAGCTGGAGGAACTCGGCCAGCGTGGATCGGCG
GCGCCGGTCGATTCCAATGCGGATGCCGGTGGCTTCGATCAATTCAACCGGGGCAAAAAC
TAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv0016c	active	sourish10	2012-10-05
	yeast-two-or-three hybrid (physical interaction) P. Mukherjee, K. Sureka et al. Novel role of Wag31 in protection of mycobacteria under oxidative stress. Mol. Microbiol. 2009
Interaction	Signaling Rv0016c	active	ahal4789	2012-10-05
	yeast-two-or-three hybrid (physical interaction) P. Mukherjee, K. Sureka et al. Novel role of Wag31 in protection of mycobacteria under oxidative stress. Mol. Microbiol. 2009
Interaction	Signaling Rv0014c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,OW. Schonecke,W. Schüffel Evaluation of combined pharmacological and psychotherapeutic treatment in patients with functional abdominal disorders. Psychother Psychosom 1975
Interaction	Signaling Rv0015c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,OW. Schonecke,W. Schüffel Evaluation of combined pharmacological and psychotherapeutic treatment in patients with functional abdominal disorders. Psychother Psychosom 1975
Interaction	Signaling Rv0014c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Signaling Rv0015c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Signaling Rv0014c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,D. Bucens,MC. Pain Influence of hematocrit, blood gas tensions, and pH on pressure-flow relations in the isolated canine lung. Circ. Res. 1975
Interaction	Signaling Rv0015c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,D. Bucens,MC. Pain Influence of hematocrit, blood gas tensions, and pH on pressure-flow relations in the isolated canine lung. Circ. Res. 1975
Interaction	Signaling Rv0014c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,PW. Hermans,F. Abebe,VI. Kuteyi,AH. Kolk,JE. Thole,M. Harboe Molecular and immunological characterization of the highly conserved antigen 84 from Mycobacterium tuberculosis and Mycobacterium leprae. Infect. Immun. 1995
Interaction	Signaling Rv0015c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,PW. Hermans,F. Abebe,VI. Kuteyi,AH. Kolk,JE. Thole,M. Harboe Molecular and immunological characterization of the highly conserved antigen 84 from Mycobacterium tuberculosis and Mycobacterium leprae. Infect. Immun. 1995
Interaction	Signaling Rv0014c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,JM. Stein The effect of adrenaline and of alpha- and beta-adrenergic blocking agents on ATP concentration and on incorporation of 32Pi into ATP in rat fat cells. Biochem. Pharmacol. 1975
Interaction	Signaling Rv0015c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,JM. Stein The effect of adrenaline and of alpha- and beta-adrenergic blocking agents on ATP concentration and on incorporation of 32Pi into ATP in rat fat cells. Biochem. Pharmacol. 1975
Interaction	Signaling Rv0014c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,H. Autrup,GP. Warwick Some characteristics of two azoreductase systems in rat liver. Relevance to the activity of 2-[4'-di(2"-bromopropyl)-aminophenylazo]benzoic acid (CB10-252), a compound possessing latent cytotoxic activity. Chem. Biol. Interact. 1975
Interaction	Signaling Rv0015c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,H. Autrup,GP. Warwick Some characteristics of two azoreductase systems in rat liver. Relevance to the activity of 2-[4'-di(2"-bromopropyl)-aminophenylazo]benzoic acid (CB10-252), a compound possessing latent cytotoxic activity. Chem. Biol. Interact. 1975
Interaction	Signaling Rv0014c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0015c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) CM. Kang, DW. Abbott et al. The Mycobacterium tuberculosis serine/threonine kinases PknA and PknB: substrate identification and regulation of cell shape. Genes Dev. 2005
Interaction	Signaling Rv0014c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,K. Hamasha,MB. Sahana,C. Jani,S. Nyayapathy,CM. Kang,SJ. Rehse The effect of Wag31 phosphorylation on the cells and the cell envelope fraction of wild-type and conditional mutants of Mycobacterium smegmatis studied by visible-wavelength Raman spectroscopy. Biochem. Biophys. Res. Commun. 2010
Interaction	Signaling Rv0015c	active	harsharohiratruefriend	2012-10-05
	Affinity purification (Physical interaction) authors,K. Hamasha,MB. Sahana,C. Jani,S. Nyayapathy,CM. Kang,SJ. Rehse The effect of Wag31 phosphorylation on the cells and the cell envelope fraction of wild-type and conditional mutants of Mycobacterium smegmatis studied by visible-wavelength Raman spectroscopy. Biochem. Biophys. Res. Commun. 2010
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Name	DivIVA family member, mediates cell division	active	mjackson	2012-10-05
	Cell division
Name	DivIVA family member, mediates cell division	active	mjackson	2012-10-05
	Cell division