Rv2441c - 50S ribosomal protein L27 rpmA

Expression: Most Significant Conditions for Rv2441c

Protein Domains

Gene Information
Locus	Rv2441c
Symbol	rpmA
Gene Name	50S ribosomal protein L27 rpmA
Location	2739772 - 2740032 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:261 bp Protein:87 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	931
Related Genes	Acel_0757 BL1283 CE2270 cg2594 DIP1780 jk0558 MAP2265c MAV_1730 Mkms_3622 ML1466 Mmcs_3549 MSMEG_4624 MT2517 MUL_3713 Mvan_3945 nfa13540 PPA0829 SAV5468
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2441c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2441c Transcript 1
MAHKKGASSSRNGRDSAAQRLGVKRYGGQVVKAGEILVRQRGTKFHPGVNVGRGGDDTLF
AKTAGAVEFGIKRGRKTVSIVGSTTA*

Genomic Sequence

>Rv2441c
ATGGCACACAAGAAGGGGGCTTCCAGCTCGCGCAACGGTCGCGATTCCGCCGCCCAGCGG
CTGGGGGTTAAGCGGTACGGCGGCCAGGTCGTCAAGGCCGGCGAGATCCTGGTCCGCCAG
CGCGGTACCAAATTCCATCCCGGCGTCAACGTCGGGCGTGGCGGCGATGACACCTTGTTC
GCCAAGACGGCCGGGGCGGTCGAGTTCGGCATCAAACGCGGACGTAAGACGGTGAGCATC
GTCGGTTCGACCACTGCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Translation Rv3414c	active	priti.priety	2012-10-05
	Co expression Analysis H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009