Rv2461c - ATP-dependent clp protease proteolytic subunit 1 clpP1

Expression: Most Significant Conditions for Rv2461c

Protein Domains

Gene Information
Locus	Rv2461c
Symbol	clpP1
Gene Name	ATP-dependent clp protease proteolytic subunit 1 clpP1
Location	2763172 - 2763774 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:603 bp Protein:201 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34711
Related Genes	CE2311 CE2312 cg2644 DIP1791 DIP1792 jk0544 jk0545 MAP2280c MAP2281c MAV_1713 MAV_1714 Mkms_3650 Mkms_3651 ML1479 Mmcs_3577 Mmcs_3578 MSMEG_4672 MSMEG_4673 MT2535 MT2536 MUL_3730 MUL_3731 Mvan_4039 Mvan_4040 nfa13330 nfa13340 Rv2460c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2461c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2461c Transcript 1
MSQVTDMRSNSQGLSLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDI
SLYINSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARI
LMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEA
LEYGFVDHIITRAHVNGEAQ*

Genomic Sequence

>Rv2461c
GTGAGCCAAGTGACTGACATGCGTTCGAACTCGCAGGGTCTTAGCCTCACGGATTCGGTC
TACGAGCGCTTGCTCTCCGAGCGCATCATCTTCCTGGGCTCGGAGGTGAACGACGAGATC
GCCAACCGGTTATGCGCTCAGATTCTGCTGCTGGCCGCCGAAGACGCCAGCAAGGACATC
AGCCTCTACATCAATTCGCCGGGTGGATCGATCAGCGCCGGCATGGCGATCTACGACACC
ATGGTGCTGGCGCCCTGTGACATCGCCACCTACGCGATGGGCATGGCCGCCTCGATGGGC
GAGTTCCTGCTGGCGGCAGGTACCAAGGGCAAGCGCTACGCGCTGCCGCATGCTCGCATC
CTGATGCACCAGCCGTTGGGCGGGGTGACCGGCAGCGCGGCCGATATCGCCATCCAGGCC
GAGCAGTTCGCCGTGATCAAGAAAGAAATGTTCCGGCTCAACGCCGAATTCACCGGCCAG
CCGATCGAGCGCATTGAGGCGGATTCCGATCGCGACCGCTGGTTCACCGCCGCCGAAGCC
CTGGAATACGGTTTCGTCGATCACATCATCACCCGCGCCCACGTCAATGGAGAAGCACAG
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2475c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) authors,M. Estorninho,H. Smith,J. Thole,J. Harders-Westerveen,A. Kierzek,RE. Butler,O. Neyrolles,GR. Stewart ClgR regulation of chaperone and protease systems is essential for Mycobacterium tuberculosis parasitism of the macrophage. Microbiology (Reading, Engl.) 2010
Interaction	PhysicalInteraction Rv2457c	active	akankshajain.21	2012-10-05
	Structural analysis authors,A. Gribun,MS. Kimber,R. Ching,R. Sprangers,KM. Fiebig,WA. Houry The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2460c	active	akankshajain.21	2012-10-05
	Structural analysis authors,A. Gribun,MS. Kimber,R. Ching,R. Sprangers,KM. Fiebig,WA. Houry The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2457c	active	akankshajain.21	2012-10-05
	Structural analysis H. Ingvarsson, MJ. Maté et al. Insights into the inter-ring plasticity of caseinolytic proteases from the X-ray structure of Mycobacterium tuberculosis ClpP1. Acta Crystallogr. D Biol. Crystallogr. 2007
Interaction	PhysicalInteraction Rv2460c	active	akankshajain.21	2012-10-05
	Structural analysis H. Ingvarsson, MJ. Maté et al. Insights into the inter-ring plasticity of caseinolytic proteases from the X-ray structure of Mycobacterium tuberculosis ClpP1. Acta Crystallogr. D Biol. Crystallogr. 2007
Interaction	PhysicalInteraction Rv2457c	active	akankshajain.21	2012-10-05
	Structural analysis AK. Gupta, VM. Katoch et al. Microarray analysis of efflux pump genes in multidrug-resistant Mycobacterium tuberculosis during stress induced by common anti-tuberculous drugs. Microb. Drug Resist. 2010
Interaction	PhysicalInteraction Rv2460c	active	akankshajain.21	2012-10-05
	Structural analysis AK. Gupta, VM. Katoch et al. Microarray analysis of efflux pump genes in multidrug-resistant Mycobacterium tuberculosis during stress induced by common anti-tuberculous drugs. Microb. Drug Resist. 2010
Interaction	Regulatory Rv2457c	active	richasinha4u	2012-10-05
	Structural Analysis authors,AY. Yu,WA. Houry ClpP: a distinctive family of cylindrical energy-dependent serine proteases. FEBS Lett. 2007
Interaction	Regulatory Rv2457c	active	richasinha4u	2012-10-05
	Structural Analysis authors,S. Gottesman,WP. Clark,MR. Maurizi The ATP-dependent Clp protease of Escherichia coli. Sequence of clpA and identification of a Clp-specific substrate. J. Biol. Chem. 1990
Interaction	Regulatory Rv2457c	active	richasinha4u	2012-10-05
	Structural Analysis authors,MR. Maurizi,WP. Clark,Y. Katayama,S. Rudikoff,J. Pumphrey,B. Bowers,S. Gottesman Sequence and structure of Clp P, the proteolytic component of the ATP-dependent Clp protease of Escherichia coli. J. Biol. Chem. 1990
Interaction	Regulatory Rv2457c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,AY. Yu,WA. Houry ClpP: a distinctive family of cylindrical energy-dependent serine proteases. FEBS Lett. 2007
Interaction	Regulatory Rv2457c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,S. Gottesman,WP. Clark,MR. Maurizi The ATP-dependent Clp protease of Escherichia coli. Sequence of clpA and identification of a Clp-specific substrate. J. Biol. Chem. 1990
Interaction	Regulatory Rv2457c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,MR. Maurizi,WP. Clark,Y. Katayama,S. Rudikoff,J. Pumphrey,B. Bowers,S. Gottesman Sequence and structure of Clp P, the proteolytic component of the ATP-dependent Clp protease of Escherichia coli. J. Biol. Chem. 1990
Interaction	PhysicalInteraction Rv2460c	active	akankshajain.21	2012-10-05
	Structural analysis authors,A. Gribun,MS. Kimber,R. Ching,R. Sprangers,KM. Fiebig,WA. Houry The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2460c	active	akankshajain.21	2012-10-05
	Structural analysis AK. Gupta, VM. Katoch et al. Microarray analysis of efflux pump genes in multidrug-resistant Mycobacterium tuberculosis during stress induced by common anti-tuberculous drugs. Microb. Drug Resist. 2010
Interaction	PhysicalInteraction Rv2457c	active	richasinha4u	2012-10-05
	Structural Analysis authors,AY. Yu,WA. Houry ClpP: a distinctive family of cylindrical energy-dependent serine proteases. FEBS Lett. 2007
Interaction	PhysicalInteraction Rv2457c	active	richasinha4u	2012-10-05
	Structural Analysis authors,LW. Donaldson,U. Wojtyra,WA. Houry Solution structure of the dimeric zinc binding domain of the chaperone ClpX. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv2457c	active	richasinha4u	2012-10-05
	Structural Analysis authors,B. Banecki,A. Wawrzynow,J. Puzewicz,C. Georgopoulos,M. Zylicz Structure-function analysis of the zinc-binding region of the Clpx molecular chaperone. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2457c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,AY. Yu,WA. Houry ClpP: a distinctive family of cylindrical energy-dependent serine proteases. FEBS Lett. 2007
Interaction	PhysicalInteraction Rv2457c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,LW. Donaldson,U. Wojtyra,WA. Houry Solution structure of the dimeric zinc binding domain of the chaperone ClpX. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv2457c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,B. Banecki,A. Wawrzynow,J. Puzewicz,C. Georgopoulos,M. Zylicz Structure-function analysis of the zinc-binding region of the Clpx molecular chaperone. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2457c	active	vmevada102	2012-10-05
	Structural analysis authors,A. Gribun,MS. Kimber,R. Ching,R. Sprangers,KM. Fiebig,WA. Houry The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2457c	active	vmevada102	2012-10-05
	Structural analysis AK. Gupta, VM. Katoch et al. Microarray analysis of efflux pump genes in multidrug-resistant Mycobacterium tuberculosis during stress induced by common anti-tuberculous drugs. Microb. Drug Resist. 2010