Rv2494 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2494

Protein Domains

Gene Information
Locus	Rv2494
Symbol
Gene Name	conserved hypothetical protein
Location	2808310 - 2808735 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:426 bp Protein:142 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9133
Related Genes	MT2569
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2494
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2494 Transcript 1
MALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIG
IADARRVLVALRAVGGHRFLADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFD
AGVFTLAQQRPKTPVELLTIL*

Genomic Sequence

>Rv2494
GTGGCGCTGCTCGACGTCAACGCATTGGTCGCGCTGGCGTGGGACTCACACATCCACCAC
GCCCGGATCCGCGAGTGGTTTACCGCCAACGCCACGCTCGGCTGGGCGACTTGCCCGCTC
ACCGAAGCCGGCTTCGTGCGGGTGTCGACGAACCCAAAAGTACTTCCCAGCGCGATCGGG
ATCGCAGACGCTCGACGGGTCCTCGTGGCACTACGCGCCGTGGGAGGCCACCGCTTCCTG
GCTGACGACGTATCGCTCGTCGATGACGATGTTCCGTTGATCGTCGGTTATCGCCAGGTG
ACCGACGCCCATCTGCTGACACTCGCCCGCCGGCGCGGCGTCCGCCTGGTCACCTTCGAC
GCCGGTGTCTTCACCCTCGCCCAACAACGCCCCAAGACGCCAGTGGAGCTGCTGACCATC
CTCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2493	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2492	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2491	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2493	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2492	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2491	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2493	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2493	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2492	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2492	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2491	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2491	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007