Rv2546 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2546

Protein Domains

Gene Information
Locus	Rv2546
Symbol
Gene Name	conserved hypothetical protein
Location	2868154 - 2868567 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:414 bp Protein:138 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	19214
Related Genes	MT2622
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2546
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2546 Transcript 1
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDG
LARIPVGAETFTRACQVQRELAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRV
AAITGQPTEWIVPRGTL*

Genomic Sequence

>Rv2546
ATGGTGTTCTGCGTCGACACCAGCGCGTGGCATCACGCGGCGCGGCCGGAAGTTGCGCGC
CGATGGTTGGCGGCCTTGTCCGCGGACCAGATCGGCATCTGCGACCACGTGCGGTTGGAG
ATCCTGTACTCGGCGAACTCCGCTACCGACTACGACGCGCTCGCCGACGAACTCGACGGC
TTGGCCCGTATACCAGTCGGTGCCGAAACCTTTACGCGCGCATGCCAAGTCCAGCGTGAG
CTTGCCCACGTCGCCGGTCTGCATCACCGCAGCGTGAAGATCGCCGATCTTGTCATCGCC
GCGGCGGCCGAACTTTCAGGCACCATCGTGTGGCATTACGACGAGAACTATGACCGGGTC
GCCGCCATCACCGGCCAACCTACGGAGTGGATCGTGCCGCGCGGGACCCTTTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2545	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2545	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv2545	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2545	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	VapC	active	jlew	2012-03-07
	authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapC18	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY159.29c (133 aa), FASTA scores: opt: 206, E(): 2.6e-07, (38.0% identity in 100 aa overlap); etc.
Other	stop:2868567	active	rslayden	2012-03-05
	MTCY159.29c (133 aa), FASTA scores: opt: 206, E(): 2.6e-07, (38.0% identity in 100 aa overlap); etc.
Other	start:2868154	active	rslayden	2012-03-05
	MTCY159.29c (133 aa), FASTA scores: opt: 206, E(): 2.6e-07, (38.0% identity in 100 aa overlap); etc.
Other	strand:+	active	rslayden	2012-03-05
	Rv2527
Other	stop:2868567	active	rslayden	2012-03-05
	Rv2527
Other	start:2868154	active	rslayden	2012-03-05
	Rv2527
Other	strand:+	active	rslayden	2012-03-05
	MTV002.22c (138 aa), FASTA scores: opt: 265, E(): 2.5e-11, (38.5% identity in 135 aa overlap); P95026
Other	stop:2868567	active	rslayden	2012-03-05
	MTV002.22c (138 aa), FASTA scores: opt: 265, E(): 2.5e-11, (38.5% identity in 135 aa overlap); P95026
Other	start:2868154	active	rslayden	2012-03-05
	MTV002.22c (138 aa), FASTA scores: opt: 265, E(): 2.5e-11, (38.5% identity in 135 aa overlap); P95026
Other	strand:+	active	rslayden	2012-03-05
	Rv2757c
Other	stop:2868567	active	rslayden	2012-03-05
	Rv2757c
Other	start:2868154	active	rslayden	2012-03-05
	Rv2757c
Other	strand:+	active	rslayden	2012-03-05
	MTCY08D5.24c (226 aa), FASTA scores: opt: 272, E(): 1.3e-11, (39.7% identity in 136 aa overlap); O33299
Other	stop:2868567	active	rslayden	2012-03-05
	MTCY08D5.24c (226 aa), FASTA scores: opt: 272, E(): 1.3e-11, (39.7% identity in 136 aa overlap); O33299
Other	start:2868154	active	rslayden	2012-03-05
	MTCY08D5.24c (226 aa), FASTA scores: opt: 272, E(): 1.3e-11, (39.7% identity in 136 aa overlap); O33299
Other	strand:+	active	rslayden	2012-03-05
	Rv0229c
Other	stop:2868567	active	rslayden	2012-03-05
	Rv0229c
Other	start:2868154	active	rslayden	2012-03-05
	Rv0229c
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to several HYPOTHETICAL PROTEINS from Mycobacterium tuberculosis (strain H37Rv and CDC1551) e.g. P96411
Other	stop:2868567	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to several HYPOTHETICAL PROTEINS from Mycobacterium tuberculosis (strain H37Rv and CDC1551) e.g. P96411
Other	start:2868154	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to several HYPOTHETICAL PROTEINS from Mycobacterium tuberculosis (strain H37Rv and CDC1551) e.g. P96411