Rv2548 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2548

Protein Domains

Gene Information
Locus	Rv2548
Symbol
Gene Name	conserved hypothetical protein
Location	2868860 - 2869237 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:378 bp Protein:126 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9146
Related Genes	MT2624
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2548
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2548 Transcript 1
MKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFS
AVVWTLVTEDIARIGGRLARRYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPD
LQPPY*

Genomic Sequence

>Rv2548
GTGAAGCTGATCGACACCACCATCGCGGTCGACCACCTTCGCGGCGAACCCGCGGCAGCC
GTGCTGCTCGCCGAACTGATAAACAACGGTGAGGAGATCGCGGCCAGCGAGCTGGTCCGA
TTCGAACTCCTCGCCGGTGTGCGGGAAAGCGAACTCGCGGCGCTCGAGGCCTTCTTCTCG
GCAGTGGTGTGGACCCTGGTGACCGAGGACATTGCCCGGATCGGCGGACGACTCGCCCGT
CGATACCGGTCCAGCCACCGCGGTATCGACGACGTGGACTACCTGATCGCTGCGACCGCC
ATTGTGGTCGACGCCGACCTGCTCACCACCAATGTGCGCCACTTCCCGATGTTCCCGGAT
CTGCAGCCGCCGTACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2547	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2547	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv2547	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2547	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	VapC-mt19	active	jlew	2012-03-07
	Expression resulted in growth arrest in E coli. Expressed 23 VapC toxins in EC lacking TA modules. 4 inhibited growth. authors,JD. Sharp,JW. Cruz,S. Raman,M. Inouye,RN. Husson,NA. Woychik Growth and translation inhibition through sequence specific RNA binding by a mycobacterium tuberculosis VAPC toxin. The Journal of biological chemistry 2012
Symbol	VapC	active	jlew	2012-03-07
	authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapC19	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	YLE HYPOTHETICAL 14.9 KDA PROTEIN from Agrobacterium radiobacter (133 aa), FASTA scores: opt: 128, E(): 0.03,(32.8% identity in 125 aa overlap); etc. TBscore is 0.865
Other	stop:2869237	active	rslayden	2012-03-05
	YLE HYPOTHETICAL 14.9 KDA PROTEIN from Agrobacterium radiobacter (133 aa), FASTA scores: opt: 128, E(): 0.03,(32.8% identity in 125 aa overlap); etc. TBscore is 0.865
Other	start:2868860	active	rslayden	2012-03-05
	YLE HYPOTHETICAL 14.9 KDA PROTEIN from Agrobacterium radiobacter (133 aa), FASTA scores: opt: 128, E(): 0.03,(32.8% identity in 125 aa overlap); etc. TBscore is 0.865
Other	strand:+	active	rslayden	2012-03-05
	SSO1975 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (125 aa), FASTA scores: opt: 131, E(): 0.018, (30.0% identity in 110 aa overlap); O52285
Other	stop:2869237	active	rslayden	2012-03-05
	SSO1975 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (125 aa), FASTA scores: opt: 131, E(): 0.018, (30.0% identity in 110 aa overlap); O52285
Other	start:2868860	active	rslayden	2012-03-05
	SSO1975 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (125 aa), FASTA scores: opt: 131, E(): 0.018, (30.0% identity in 110 aa overlap); O52285
Other	strand:+	active	rslayden	2012-03-05
	MTCY21B4.14c HYPOTHETICAL 15.0 KDA PROTEIN from Mycobacterium tuberculosis (133 aa), FASTA scores: opt: 265, E(): 7.1e-12, (42.3% identity in 123 aa overlap); Q97WY5
Other	stop:2869237	active	rslayden	2012-03-05
	MTCY21B4.14c HYPOTHETICAL 15.0 KDA PROTEIN from Mycobacterium tuberculosis (133 aa), FASTA scores: opt: 265, E(): 7.1e-12, (42.3% identity in 123 aa overlap); Q97WY5
Other	start:2868860	active	rslayden	2012-03-05
	MTCY21B4.14c HYPOTHETICAL 15.0 KDA PROTEIN from Mycobacterium tuberculosis (133 aa), FASTA scores: opt: 265, E(): 7.1e-12, (42.3% identity in 123 aa overlap); Q97WY5
Other	strand:+	active	rslayden	2012-03-05
	Rv1397c
Other	stop:2869237	active	rslayden	2012-03-05
	Rv1397c
Other	start:2868860	active	rslayden	2012-03-05
	Rv1397c
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to various proteins e.g. P71665
Other	stop:2869237	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to various proteins e.g. P71665
Other	start:2868860	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to various proteins e.g. P71665