Rv2550c - hypothetical protein

Expression: Most Significant Conditions for Rv2550c

Protein Domains

Gene Information
Locus	Rv2550c
Symbol
Gene Name	hypothetical protein
Location	2870119 - 2870364 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:246 bp Protein:82 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9148
Related Genes	MT2627
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2550c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2550c Transcript 1
MLVAYICHVKRLQIYIDEDVDRALAVEARRRRTSKAALIREYVAEHLRQPGPDPVDAFVG
SFVGEADLSASVDDVVYGKHE*

Genomic Sequence

>Rv2550c
ATGCTAGTGGCGTATATTTGCCATGTGAAAAGGCTGCAGATCTACATCGACGAAGACGTT
GACCGAGCGCTTGCTGTTGAAGCGCGACGGCGGCGGACGTCGAAGGCGGCGCTGATCCGG
GAGTACGTCGCTGAGCACCTCCGGCAGCCGGGCCCAGATCCGGTCGATGCCTTCGTCGGA
TCGTTCGTGGGGGAAGCCGACTTGTCCGCGTCCGTCGACGACGTGGTTTACGGAAAGCAC
GAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv2549c	active	gaurisd10	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibition Rv2549c	active	gaurisd10	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibition Rv2549c	active	gaurisd10	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibition Rv2549c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibition Rv2549c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibition Rv2549c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv2549c	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2549c	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	VapB	active	jlew	2012-03-07
	Rescues growth inhibition in MS authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapB20	active	jlew	2012-03-07
	Relieves toxin activity. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Hypothetical unknown protein
Other	stop:2870364	active	rslayden	2012-03-05
	Hypothetical unknown protein
Other	start:2870119	active	rslayden	2012-03-05
	Hypothetical unknown protein
Symbol	Vap BC-20	active	rslayden	2012-03-05
	Hypothetical unknown protein