Rv2594c - crossover junction endodeoxyribonuclease ruvC

Expression: Most Significant Conditions for Rv2594c

Protein Domains

Gene Information
Locus	Rv2594c
Symbol	ruvC
Gene Name	crossover junction endodeoxyribonuclease ruvC
Location	2924817 - 2925383 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:567 bp Protein:189 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	714
Related Genes	Acel_1345 BL0727 CE1775 cg1871 DIP1377 jk1056 MAP1036 MAV_3475 Mkms_2312 ML0481 Mmcs_2265 MSMEG_2943 MT2671 MUL_1714 Mvan_2573 nfa36970 PPA1158 SAV6833
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2594c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2594c Transcript 1
MRVMGVDPGLTRCGLSLIESGRGRQLTALDVDVVRTPSDAALAQRLLAISDAVEHWLDTH
HPEVVAIERVFSQLNVTTVMGTAQAGGVIALAAAKRGVDVHFHTPSEVKAAVTGNGSADK
AQVTAMVTKILALQAKPTPADAADALALAICHCWRAPTIARMAEATSRAEARAAQQRHAY
LAKLKAAR*

Genomic Sequence

>Rv2594c
GTGCGGGTGATGGGTGTCGATCCCGGGTTGACCCGATGCGGGCTGTCGCTTATCGAGAGT
GGGCGTGGTCGGCAGCTCACCGCGCTGGATGTCGACGTGGTGCGCACACCGTCGGATGCG
GCCTTGGCGCAGCGCCTGTTGGCCATCAGCGATGCCGTCGAGCACTGGCTGGACACCCAT
CATCCGGAGGTGGTGGCTATCGAACGGGTGTTCTCTCAGCTCAACGTGACCACGGTGATG
GGCACCGCGCAGGCCGGCGGCGTGATCGCCCTGGCGGCGGCCAAACGTGGTGTCGACGTG
CATTTCCATACCCCCAGCGAGGTCAAGGCGGCGGTCACTGGCAACGGTTCCGCAGACAAG
GCTCAGGTCACCGCGATGGTCACCAAAATCCTTGCGCTGCAAGCTAAACCGACACCGGCC
GACGCGGCCGACGCTTTGGCGCTGGCGATCTGTCACTGTTGGCGGGCGCCGACGATCGCC
CGGATGGCTGAGGCCACGTCGAGGGCGGAAGCACGAGCAGCGCAGCAGCGTCATGCGTAC
CTAGCCAAGCTGAAGGCCGCCCGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2603c	active	sureshks89	2012-10-05
	authors,MY. Galperin,EV. Koonin From complete genome sequence to 'complete' understanding? Trends Biotechnol. 2010
Interaction	PhysicalInteraction Rv2603c	active	sureshks89	2012-10-05
	authors,H. Liang,L. Li,Z. Dong,MG. Surette,K. Duan The YebC family protein PA0964 negatively regulates the Pseudomonas aeruginosa quinolone signal system and pyocyanin production. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Interaction	Regulatory Rv0616c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Other	TBPWY:Recombination repair	active	vmizrahi	2012-03-05
	Increased expression in Mtb from clinical lung samples
Other	TBPWY:Recombination repair	active	vmizrahi	2012-03-05
	recA-independent DNA damage-induced