Rv2611c - acyltransferase

Expression: Most Significant Conditions for Rv2611c

Protein Domains

Gene Information
Locus	Rv2611c
Symbol
Gene Name	acyltransferase
Location	2939012 - 2939962 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:951 bp Protein:317 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18991
Related Genes	Acel_1354 CE1782 cg1877 DIP1385 jk1063 MAP2713c MAV_3487 Mkms_2292 ML0453 Mmcs_2245 MSMEG_2934 MT2686 MUL_3253 Mvan_2561 nfa2730 nfa37090 SAV6827
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2611c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2611c Transcript 1
MIAGLKGLKLPKDPRSSVTRTATDWAYAAGWMAVRALPEFAVRNAFDTGARYFARHGGPE
QLRKNLARVLGVPPAAVPDPLMCASLESYGRYWREVFRLPTINHRKLARQLDRVIGGLDH
LDAALAAGLGAVLALPHSGNWDMAGMWLVQRHGTFTTVAERLKPESLYQRFIDYRESLGF
EVLPLSGGERPPFEVLSERLRNNRVVCLMAERDLTRTGVEVDFFGEPTRMPVGPAKLAVE
TGAALLPTHCWFEGRGWGFQVYPALDCTSGDVAAITQALADRFAQNIAAHPADWHMLQPQ
WLADLSESRRAQLRSR*

Genomic Sequence

>Rv2611c
GTGATTGCCGGCCTTAAGGGCTTGAAGCTGCCCAAAGATCCGCGCAGTTCCGTGACGCGC
ACCGCGACCGACTGGGCGTATGCGGCCGGCTGGATGGCCGTACGGGCGCTGCCAGAGTTC
GCCGTACGCAACGCATTCGACACCGGAGCGCGCTACTTTGCCCGCCACGGCGGGCCCGAG
CAGCTGCGCAAGAACCTGGCCCGCGTCCTGGGTGTGCCGCCAGCCGCGGTGCCGGACCCG
CTGATGTGCGCCTCGCTGGAGTCCTACGGGCGCTACTGGCGTGAGGTGTTCCGGCTGCCG
ACGATAAACCACCGCAAGCTGGCCCGCCAGCTCGACCGCGTGATCGGTGGACTGGATCAC
CTGGACGCGGCGCTGGCCGCGGGCCTCGGTGCCGTGCTGGCGTTGCCGCACAGCGGCAAC
TGGGATATGGCCGGGATGTGGCTGGTGCAGCGGCACGGCACCTTCACCACCGTCGCCGAG
CGCCTAAAACCCGAATCGCTGTACCAGCGCTTTATCGACTACCGCGAAAGCCTGGGATTT
GAGGTGCTGCCGCTGTCCGGCGGCGAACGGCCGCCGTTCGAGGTGCTCTCTGAGCGGCTG
AGGAACAACCGAGTGGTCTGCCTGATGGCCGAGCGCGATCTCACCCGCACCGGTGTTGAG
GTCGACTTCTTCGGCGAGCCCACCCGGATGCCGGTGGGGCCGGCGAAGCTGGCGGTCGAG
ACCGGTGCGGCATTGCTGCCCACACATTGCTGGTTCGAGGGCCGCGGCTGGGGTTTCCAG
GTGTATCCGGCGCTGGATTGCACCAGCGGTGACGTCGCTGCCATCACACAGGCGCTGGCC
GACCGCTTCGCGCAGAACATTGCCGCCCATCCCGCGGATTGGCACATGCTGCAGCCCCAG
TGGCTGGCCGACTTATCCGAATCGCGGCGGGCGCAACTGAGGTCCAGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:MANAT2 mannosyl acyl transferase - IPI	active	njamshidi	2012-10-05
	presently only adding C16:0 onto PIM core - R3 position may be C16 or C19; R4 may be C16, C18, or C19 - see for example PMID: 14627436 authors,YS. Morita,JH. Patterson,H. Billman-Jacobe,MJ. McConville Biosynthesis of mycobacterial phosphatidylinositol mannosides. Biochem. J. 2004
Term	TBRXN:MANAT2 mannosyl acyl transferase - ISS	active	njamshidi	2012-10-05
	presently only adding C16:0 onto PIM core - R3 position may be C16 or C19; R4 may be C16, C18, or C19 - see for example PMID: 14627436 authors,YS. Morita,JH. Patterson,H. Billman-Jacobe,MJ. McConville Biosynthesis of mycobacterial phosphatidylinositol mannosides. Biochem. J. 2004
Term	TBRXN:MANAT1 mannosyl acyl transferase - IPI	active	njamshidi	2012-10-05
	presently only adding C16:0 onto PIM core - R3 position may be C16 or C19; R4 may be C16, C18, or C19 - see for example PMID: 14627436 authors,YS. Morita,JH. Patterson,H. Billman-Jacobe,MJ. McConville Biosynthesis of mycobacterial phosphatidylinositol mannosides. Biochem. J. 2004
Term	TBRXN:MANAT1 mannosyl acyl transferase - ISS	active	njamshidi	2012-10-05
	presently only adding C16:0 onto PIM core - R3 position may be C16 or C19; R4 may be C16, C18, or C19 - see for example PMID: 14627436 authors,YS. Morita,JH. Patterson,H. Billman-Jacobe,MJ. McConville Biosynthesis of mycobacterial phosphatidylinositol mannosides. Biochem. J. 2004
Interaction	PhysicalInteraction Rv2610c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PJ. Brennan Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. Tuberculosis (Edinb) 2003
Interaction	PhysicalInteraction Rv2609c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PJ. Brennan Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. Tuberculosis (Edinb) 2003
Interaction	PhysicalInteraction Rv2610c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PJ. Brennan Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. Tuberculosis (Edinb) 2003
Interaction	PhysicalInteraction Rv2609c	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,PJ. Brennan Structure, function, and biogenesis of the cell wall of Mycobacterium tuberculosis. Tuberculosis (Edinb) 2003
Name	Acyltransferase involved in the 6-O-acylation of the Man residue linked to the 2-position of myo-Inositol in PIM1 and PIM2; essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished result)	active	mjackson	2012-10-05
	PIM, LM and LAM biosynthesis
Name	Acyltransferase involved in the 6-O-acylation of the Man residue linked to the 2-position of myo-Inositol in PIM1 and PIM2; essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished result)	active	mjackson	2012-10-05
	PIM, LM and LAM biosynthesis
Other	TBPWY:PIM, LM and LAM biosynthesis	active	mjackson	2012-03-05
	Acyltransferase involved in the 6-O-acylation of the Man residue linked to the 2-position of myo-Inositol in PIM1 and PIM2 (phenotypic [mycobacterial recombinant strains]; enzymatic); essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished) ME. Guerin, D. Kaur et al. New insights into the early steps of phosphatidylinositol mannoside biosynthesis in mycobacteria: PimB' is an essential enzyme of Mycobacterium smegmatis. J. Biol. Chem. 2009
Other	TBPWY:PIM, LM and LAM biosynthesis	active	mjackson	2012-03-05
	Acyltransferase involved in the 6-O-acylation of the Man residue linked to the 2-position of myo-Inositol in PIM1 and PIM2 (phenotypic [mycobacterial recombinant strains]; enzymatic); essential gene in M. tb (Barilone, Stadthagen, Jackson; unpublished) J. Korduláková, M. Gilleron et al. Identification of the required acyltransferase step in the biosynthesis of the phosphatidylinositol mannosides of mycobacterium species. J. Biol. Chem. 2003