Rv2745c - transcriptional regulator

Expression: Most Significant Conditions for Rv2745c

Protein Domains

Gene Information
Locus	Rv2745c
Symbol
Gene Name	transcriptional regulator
Location	3058193 - 3058531 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:339 bp Protein:113 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32847
Related Genes	BL1414 CE1855 cg2152 DIP1456 jk1122 MAP2856c MAV_3636 Mkms_2171 Mmcs_2125 MSMEG_2694 MT2816 MUL_3387 Mvan_2397 nfa38560 PPA1009 SAV2505
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2745c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2745c Transcript 1
MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTAL
QLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTKVVIAPVVSLAVA*

Genomic Sequence

>Rv2745c
ATGGCGGCTTTGGTGCGTGAGGTCGTTGGTGACGTGCTGCGCGGAGCGCGGATGTCGCAG
GGTCGGACGCTGCGCGAGGTGTCCGATTCGGCGCGGGTGAGCCTCGGGTATCTGTCGGAG
ATCGAGCGCGGTCGCAAGGAGCCTTCCAGCGAGCTGCTCAGTGCGATTTGTACGGCTCTG
CAGCTCCCGTTGTCGGTGGTGCTCATCGATGCGGGCGAGCGGATGGCGCGTCAAGAGCGC
CTTGCCCGCGCCACCCCGGCTGGCAGAGCAACCGGCGCCACCATTGACGCCAGCACCAAG
GTCGTCATTGCGCCGGTGGTGTCGCTGGCGGTGGCCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2939	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2939	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2935	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2935	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2934	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2934	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2933	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2933	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2932	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2932	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2931	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2931	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2930	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2930	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2745c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv2745c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv2743c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1221	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv1221	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) PA. Fontán, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008
Interaction	Regulatory Rv1221	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Regulatory Rv2744c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv2744c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2743c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv2743c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulates Rv3418c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3417c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2939	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2938	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2937	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2936	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2935	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2934	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2933	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2932	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2931	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv2930	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008