Rv2780 - 40 kda secreted L-alanine dehydrogenase ald

Expression: Most Significant Conditions for Rv2780

Protein Domains

Gene Information
Locus	Rv2780
Symbol	ald
Gene Name	40 kda secreted L-alanine dehydrogenase ald
Location	3086820 - 3087935 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1116 bp Protein:372 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33373
Related Genes	Acel_1288 MAP2888 MAV_3674 Mkms_2150 ML1532 Mmcs_2104 MSMEG_2659 MT2850 MUL_2154 Mvan_2355 nfa16250 PPA2268 PPA2274 SAV6507
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2780
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2780 Transcript 1
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGT
ADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETV
QTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAG
YNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVL
VPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVAN
MPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLG
VPFTEPASVLA*

Genomic Sequence

>Rv2780
ATGCGCGTCGGTATTCCGACCGAGACCAAAAACAACGAATTCCGGGTGGCCATCACCCCG
GCCGGCGTCGCGGAACTAACCCGTCGTGGCCATGAGGTGCTCATCCAGGCAGGTGCCGGA
GAGGGCTCGGCTATCACCGACGCGGATTTCAAGGCGGCAGGCGCGCAACTGGTCGGCACC
GCCGACCAGGTGTGGGCCGACGCTGATTTATTGCTCAAGGTCAAAGAACCGATAGCGGCG
GAATACGGCCGCCTGCGACACGGGCAGATCTTGTTCACGTTCTTGCATTTGGCCGCGTCA
CGTGCTTGCACCGATGCGTTGTTGGATTCCGGCACCACGTCAATTGCCTACGAGACCGTC
CAGACCGCCGACGGCGCACTACCCCTGCTTGCCCCGATGAGCGAAGTCGCCGGTCGACTC
GCCGCCCAGGTTGGCGCTTACCACCTGATGCGAACCCAAGGGGGCCGCGGTGTGCTGATG
GGCGGGGTGCCCGGCGTCGAACCGGCCGACGTCGTGGTGATCGGCGCCGGCACCGCCGGC
TACAACGCAGCCCGCATCGCCAACGGCATGGGCGCGACCGTTACGGTTCTAGACATCAAC
ATCGACAAACTTCGGCAACTCGACGCCGAGTTCTGCGGCCGGATCCACACTCGCTACTCA
TCGGCCTACGAGCTCGAGGGTGCCGTCAAACGTGCCGACCTGGTGATTGGGGCCGTCCTG
GTGCCAGGCGCCAAGGCACCCAAATTAGTCTCGAATTCACTTGTCGCGCATATGAAACCA
GGTGCGGTACTGGTGGATATAGCCATCGACCAGGGCGGCTGTTTCGAAGGCTCACGACCG
ACCACCTACGACCACCCGACGTTCGCCGTGCACGACACGCTGTTTTACTGCGTGGCGAAC
ATGCCCGCCTCGGTGCCGAAGACGTCGACCTACGCGCTGACCAACGCGACGATGCCGTAT
GTGCTCGAGCTTGCCGACCATGGCTGGCGGGCGGCGTGCCGGTCGAATCCGGCACTAGCC
AAAGGTCTTTCGACGCACGAAGGGGCGTTACTGTCCGAACGGGTGGCCACCGACCTGGGG
GTGCCGTTCACCGAGCCCGCCAGCGTGCTGGCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2779c	active	sumaavasthi	2012-10-05
	Operon (Functional linkage) authors,Z. Feng,NE. Cáceres,G. Sarath,RG. Barletta Mycobacterium smegmatis L-alanine dehydrogenase (Ald) is required for proficient utilization of alanine as a sole nitrogen source and sustained anaerobic growth. J. Bacteriol. 2002
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Term	EC:1.5.1.7 Saccharopine dehydrogenase (NAD(+), L-lysine-forming). - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity authors,V. Usha,R. Jayaraman,JC. Toro,SE. Hoffner,KS. Das Glycine and alanine dehydrogenase activities are catalyzed by the same protein in Mycobacterium smegmatis: upregulation of both activities under microaerophilic adaptation. Can. J. Microbiol. 2002
Term	EC:1.4.1.1 Alanine dehydrogenase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity authors,V. Usha,R. Jayaraman,JC. Toro,SE. Hoffner,KS. Das Glycine and alanine dehydrogenase activities are catalyzed by the same protein in Mycobacterium smegmatis: upregulation of both activities under microaerophilic adaptation. Can. J. Microbiol. 2002
Term	EC:1.4.1.10 Glycine dehydrogenase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity authors,V. Usha,R. Jayaraman,JC. Toro,SE. Hoffner,KS. Das Glycine and alanine dehydrogenase activities are catalyzed by the same protein in Mycobacterium smegmatis: upregulation of both activities under microaerophilic adaptation. Can. J. Microbiol. 2002
Term	EC:1.4.1.1 Alanine dehydrogenase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay authors,SH. Fisher Glutamate synthesis in Streptomyces coelicolor. J. Bacteriol. 1989