Rv2935 - phenolpthiocerol synthesis type-I polyketide synthase ppsE

Expression: Most Significant Conditions for Rv2935

Protein Domains

Gene Information
Locus	Rv2935
Symbol	ppsE
Gene Name	phenolpthiocerol synthesis type-I polyketide synthase ppsE
Location	3267737 - 3272203 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:4467 bp Protein:1489 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	30809
Related Genes	MAP3764c Mkms_2876 Mkms_2877 ML0139 ML2353 ML2354 Mmcs_2832 Mmcs_2833 MT3005 MT3010 MUL_2010 MUL_2015 Mvan_3123 Mvan_3124 Rv2940c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2935
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2935 Transcript 1
MSIPENAIAVVGMAGRFPGAKDVSAFWSNLRRGKESIVTLSEQELRDAGVSDKTLADPAY
VRRAPLLDGIDEFDAGFFGFPPLAAQVLDPQHRLFLQCAWHALEDAGADPARFDGSIGVY
GTSSPSGYLLHNLLSHRDPNAVLAEGLNFDQFSLFLQNDKDFLATRISHAFNLRGPSIAV
QTACSSSLVAVHLACLSLLSGECDMALAGGSSLCIPHRVGYFTSPGSMVSAVGHCRPFDV
RADGTVFGSGVGLVVLKPLAAAIDAGDRIHAVIRGSAINNDGSAKMGYAAPNPAAQADVI
AEAHAVSGIDSSTVSYVECHGTGTPLGDPIEIQGLRAAFEVSQTSRSAPCVLGSVKSNIG
HLEVAAGIAGLIKTILCLKNKALPATLHYTSPNPELRLDQSPFVVQSKYGPWECDGVRRA
GVSSFGVGGTNAHVVLEEAPAEASEVSAHAEPAGPQVILLSAQTAAALGESRTALAAALE
TQDGPRLSDVAYTLARRRKHNVTMAAVVHDREHAATVLRAAEHDNVFVGEAAHDGEHGDR
ADAAPTSDRVVFLFPGQGAQHVGMAKGLYDTEPVFAQHFDTCAAGFRDETGIDLHAEVFD
GTATDLERIDRSQPALFTVEYALAKLVDTFGVRAGAYIGYSTGEYIAATLAGVFDLQTAI
KTVSLRARLMHESPPGAMVAVALGPDDVTQYLPPEVELSAVNDPGNCVVAGPKDQIRALR
QRLTEAGIPVRRVRATHAFHTSAMDPMLGQFQEFLSRQQLRPPRTPLLSNLTGSWMSDQQ
VVDPASWTRQISSPIRFADELDVVLAAPSRILVEVGPGGSLTGSAMRHPKWSTTHRTVRL
MRHPLQDVDDRDTFLRALGELWSAGVEVDWTPRRPAVPHLVSLPGYPFARQRHWVEPNHT
VWAQAPGANNGSPAGTADGSTAATVDAARNGESQTEVTLQRIWSQCLGVSSVDRNANFFD
LGGDSLMAISIAMAAANEGLTITPQDLYEYPTLASLTAAVDASFASSGLAKPPEAQANPA
VPPNVTYFLDRGLRDTGRCRVPLILRLDPKIGLPDIRAVLTAVVNHHDALRLHLVGNDGI
WEQHIAAPAEFTGLSNRSVPNGVAAGSPEERAAVLGILAELLEDQTDPNAPLAAVHIAAA
HGGPHYLCLAIHAMVTDDSSRQILATDIVTAFGQRLAGEEITLEPVSTGWREWSLRCAAL
ATHPAALDTRSYWIENSTKATLWLADALPNAHTAHPPRADELTKLSSTLSVEQTSELDDG
RRRFRRSIQTILLAALGRTIAQTVGEGVVAVELEGEGRSVLRPDVDLRRTVGWFTTYYPV
PLACATGLGALAQLDAVHNTLKSVPHYGIGYGLLRYVYAPTGRVLGAQRTPDIHFRYAGV
IPELPSGDAPVQFDSDMTLPVREPIPGMGHAIELRVYRFGGSLHLDWWYDTRRIPAATAE
ALERTFPLALSALIQEAIAAEHTEHDDSEIVGEPEAGALVDLSSMDAG*

Genomic Sequence

>Rv2935
GTGAGCATCCCCGAGAACGCGATCGCGGTGGTCGGCATGGCCGGCCGATTTCCGGGCGCC
AAGGATGTTTCGGCGTTCTGGAGCAACCTTCGGCGCGGTAAGGAGTCGATCGTCACCCTG
TCCGAACAGGAGCTGCGCGACGCCGGCGTCAGCGACAAGACGCTGGCCGATCCGGCGTAT
GTGCGTCGCGCCCCGCTTCTTGACGGGATCGACGAGTTCGACGCCGGCTTCTTCGGGTTC
CCGCCGCTGGCCGCGCAGGTGCTGGATCCCCAACACCGGTTGTTCCTGCAGTGTGCATGG
CATGCGCTCGAGGACGCGGGCGCTGACCCCGCACGGTTCGACGGCTCGATCGGCGTATAC
GGAACCAGCTCCCCCAGCGGCTATCTGCTGCACAACCTGCTGTCGCATCGCGACCCGAAC
GCTGTGTTGGCCGAGGGACTCAACTTCGACCAGTTCAGCCTGTTCTTGCAGAATGACAAG
GACTTTCTGGCAACCCGGATTTCGCACGCGTTCAACCTGCGCGGGCCGAGCATCGCGGTG
CAAACCGCGTGTTCATCGTCGCTGGTAGCGGTGCATCTGGCCTGCCTGAGCCTGCTATCC
GGCGAATGCGACATGGCGTTGGCCGGCGGGTCGTCGCTATGCATCCCGCACCGTGTCGGC
TACTTCACCTCACCGGGATCGATGGTGTCGGCGGTGGGCCACTGTCGGCCCTTCGACGTG
CGGGCCGACGGCACGGTCTTCGGCAGCGGTGTCGGGTTGGTGGTGCTCAAGCCGCTGGCG
GCCGCCATCGACGCCGGAGACCGGATTCACGCCGTCATCCGCGGATCGGCGATCAACAAC
GACGGATCGGCGAAGATGGGGTATGCGGCGCCCAACCCGGCCGCTCAAGCCGATGTCATC
GCCGAAGCCCATGCGGTGTCCGGCATCGATTCGTCGACCGTGAGCTATGTCGAGTGCCAC
GGAACCGGCACCCCGCTCGGTGATCCTATCGAAATCCAGGGCCTGCGAGCGGCGTTCGAG
GTGTCGCAGACGAGCCGTTCGGCCCCTTGTGTTCTGGGGTCGGTCAAGTCGAACATCGGC
CACCTGGAAGTTGCTGCCGGCATCGCGGGTCTGATCAAAACGATTCTGTGCCTAAAGAAC
AAGGCACTACCCGCGACGCTGCACTACACCAGCCCGAACCCGGAACTGCGCTTGGACCAA
AGTCCGTTCGTCGTGCAAAGCAAGTACGGCCCCTGGGAGTGCGACGGCGTTCGTCGTGCC
GGGGTGAGTTCGTTCGGGGTCGGGGGTACCAACGCGCACGTCGTCTTGGAGGAGGCGCCA
GCAGAAGCATCGGAGGTTTCAGCGCACGCCGAGCCGGCTGGCCCTCAGGTAATCCTGCTC
TCGGCGCAAACGGCCGCGGCGCTCGGCGAGTCGCGGACCGCCCTGGCCGCGGCGCTAGAA
ACGCAAGACGGCCCGCGCCTGTCCGACGTGGCCTACACGCTCGCCCGGCGCCGCAAGCAC
AACGTCACGATGGCCGCCGTCGTGCACGACCGCGAGCACGCGGCCACCGTGCTGCGGGCG
GCCGAGCACGACAACGTTTTCGTTGGCGAAGCCGCCCACGATGGGGAGCATGGCGATCGC
GCCGACGCCGCACCCACGTCGGATCGCGTCGTTTTCCTGTTTCCCGGACAGGGCGCTCAG
CACGTCGGAATGGCAAAAGGGCTCTATGACACCGAGCCGGTCTTCGCCCAACACTTCGAC
ACCTGCGCCGCCGGATTCCGCGACGAGACAGGCATCGACTTGCATGCCGAAGTGTTCGAC
GGGACCGCAACAGATCTTGAGCGCATTGACCGTTCGCAACCGGCATTGTTCACGGTGGAA
TACGCGCTCGCGAAGTTGGTCGACACTTTCGGCGTGCGCGCCGGGGCGTACATCGGATAC
AGCACCGGCGAATACATCGCGGCCACCCTGGCCGGCGTATTCGACCTGCAGACAGCGATC
AAAACGGTGTCGCTGCGCGCCCGCCTTATGCATGAGTCGCCGCCCGGTGCCATGGTCGCG
GTGGCTCTTGGCCCCGATGACGTCACGCAGTACCTGCCACCGGAGGTCGAGCTGTCCGCG
GTAAACGATCCTGGTAACTGTGTGGTCGCCGGGCCCAAAGACCAGATCCGTGCACTGCGC
CAACGTCTTACCGAGGCAGGGATTCCCGTTCGCCGCGTCCGGGCAACCCACGCGTTCCAT
ACCAGCGCGATGGATCCCATGCTGGGCCAATTCCAAGAATTCCTGTCCCGTCAACAGCTA
CGTCCTCCGCGCACACCGCTGCTGAGCAACCTCACCGGTAGCTGGATGTCCGACCAGCAA
GTAGTCGATCCGGCCAGCTGGACGCGTCAAATCAGCTCCCCCATCAGGTTCGCCGACGAG
CTGGACGTGGTGCTGGCAGCTCCAAGTCGAATCCTGGTCGAGGTTGGTCCGGGCGGCAGC
CTGACCGGTTCGGCTATGCGCCACCCGAAGTGGTCGACCACGCACCGCACCGTTCGGCTT
ATGCGCCACCCACTGCAAGACGTCGACGACCGCGACACTTTTCTGCGCGCGCTGGGCGAA
CTCTGGTCTGCCGGAGTCGAGGTCGACTGGACGCCGCGGCGTCCGGCGGTGCCGCACCTC
GTTTCCCTGCCGGGTTATCCATTTGCCCGTCAACGGCATTGGGTCGAACCTAACCACACG
GTTTGGGCGCAGGCTCCCGGCGCAAACAACGGCTCACCGGCCGGCACTGCGGATGGTTCC
ACGGCCGCCACCGTCGATGCAGCCCGCAACGGAGAGTCGCAGACCGAGGTTACGCTGCAA
CGCATCTGGTCACAGTGCCTCGGCGTCAGCTCGGTCGATCGGAACGCCAATTTCTTCGAC
CTCGGCGGCGATTCTTTGATGGCGATCAGCATCGCGATGGCCGCCGCCAACGAGGGTCTG
ACCATCACGCCGCAGGATCTCTACGAATACCCGACCCTGGCCTCGCTGACGGCCGCCGTC
GACGCGTCGTTCGCGTCCAGCGGGTTGGCGAAGCCCCCGGAGGCACAAGCGAACCCGGCG
GTTCCACCCAACGTCACGTACTTCCTCGACCGCGGATTGCGCGACACCGGCCGCTGTCGT
GTCCCGCTGATCCTGCGCCTGGATCCCAAGATCGGGCTACCGGATATTCGAGCGGTGCTG
ACCGCAGTGGTCAACCACCACGACGCATTGCGCCTGCACCTGGTCGGCAACGATGGGATA
TGGGAGCAGCACATCGCGGCACCCGCAGAATTCACCGGGCTTTCCAACCGGTCGGTGCCC
AACGGCGTGGCTGCAGGCAGCCCCGAGGAACGGGCCGCGGTCTTGGGCATCCTGGCCGAA
CTCCTTGAGGATCAAACGGATCCGAACGCGCCGCTGGCTGCCGTTCATATCGCCGCCGCG
CACGGCGGTCCGCACTATCTGTGCCTTGCCATACATGCGATGGTCACCGACGACTCATCG
CGCCAGATCCTGGCGACCGACATCGTCACCGCGTTTGGACAACGGCTGGCAGGCGAGGAG
ATCACGCTGGAACCGGTCAGCACGGGGTGGCGGGAATGGTCACTGCGTTGCGCGGCCCTC
GCGACGCATCCGGCGGCGCTGGACACTCGCTCGTACTGGATCGAGAATTCGACCAAGGCG
ACTTTGTGGCTGGCCGATGCCCTTCCCAACGCGCATACCGCCCATCCGCCCCGCGCCGAC
GAGCTCACCAAGTTGTCGAGCACGCTAAGCGTCGAGCAGACATCCGAGCTGGACGACGGC
CGGCGCAGGTTCCGCCGGTCGATTCAGACGATCCTGCTGGCCGCCCTCGGCCGCACAATA
GCTCAGACGGTAGGTGAGGGTGTGGTCGCCGTGGAGCTCGAAGGCGAGGGCCGCTCGGTG
CTGCGGCCGGATGTCGACCTGCGCAGAACGGTCGGCTGGTTCACGACGTACTACCCGGTA
CCGCTGGCATGCGCAACAGGGCTGGGCGCGCTTGCGCAGCTGGACGCGGTGCACAACACT
CTTAAGTCCGTTCCGCACTACGGAATTGGATACGGGCTGCTGCGCTACGTTTACGCCCCG
ACCGGACGTGTCCTGGGCGCTCAGCGCACACCCGACATTCACTTCCGGTATGCGGGCGTG
ATCCCCGAGCTACCGTCCGGCGATGCTCCAGTACAGTTCGACTCGGACATGACGCTTCCG
GTGCGCGAACCGATCCCAGGGATGGGCCACGCCATCGAACTTCGGGTGTATCGGTTTGGT
GGCTCACTGCATCTCGATTGGTGGTACGACACCCGCCGGATCCCGGCGGCAACGGCAGAA
GCGCTGGAGCGGACCTTCCCGCTGGCCCTCAGCGCGCTGATCCAGGAGGCCATCGCGGCC
GAGCACACAGAGCACGACGACAGCGAGATAGTCGGGGAACCCGAGGCGGGCGCTCTGGTG
GACCTGTCGAGCATGGATGCCGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:PREPTHS2 phenolic phthiocerol precursor synthesis - IDA	active	njamshidi	2012-10-05
	see PMID: 12031661, 9201977, 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	TBRXN:PREPTHS2 phenolic phthiocerol precursor synthesis - IDA	active	njamshidi	2012-10-05
	see PMID: 12031661, 9201977, 15668773 authors,AK. Azad,TD. Sirakova,ND. Fernandes,PE. Kolattukudy Gene knockout reveals a novel gene cluster for the synthesis of a class of cell wall lipids unique to pathogenic mycobacteria. J. Biol. Chem. 1997
Term	TBRXN:PREPTHS2 phenolic phthiocerol precursor synthesis - IDA	active	njamshidi	2012-10-05
	see PMID: 12031661, 9201977, 15668773 authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
Term	TBRXN:PREPTHS phthiocerol precursor synthesis - IDA	active	njamshidi	2012-10-05
	see PMID: 12031661, 9201977, 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	TBRXN:PREPTHS phthiocerol precursor synthesis - IDA	active	njamshidi	2012-10-05
	see PMID: 12031661, 9201977, 15668773 authors,AK. Azad,TD. Sirakova,ND. Fernandes,PE. Kolattukudy Gene knockout reveals a novel gene cluster for the synthesis of a class of cell wall lipids unique to pathogenic mycobacteria. J. Biol. Chem. 1997
Term	TBRXN:PREPTHS phthiocerol precursor synthesis - IDA	active	njamshidi	2012-10-05
	see PMID: 12031661, 9201977, 15668773 authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2938	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2937	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2936	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2930	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2938	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2937	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2936	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2930	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	Regulatory Rv3692	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv3416	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2745c	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2034	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv0445c	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv0117	active	ashwinigbhat	2012-10-05
	One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv3692	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3416	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2745c	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2034	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv0445c	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv0117	active	ashwinigbhat	2012-10-05
	One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2930	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2930	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2928	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) authors,M. Jackson,G. Stadthagen,B. Gicquel Long-chain multiple methyl-branched fatty acid-containing lipids of Mycobacterium tuberculosis: biosynthesis, transport, regulation and biological activities. Tuberculosis (Edinb) 2007
Interaction	PhysicalInteraction Rv2928	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3692	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2745c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0117	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Name	Type 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectively	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Name	Type 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectively	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Type 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectively (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Type 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectively (phenotypic [mycobacterial recombinant strains]; enzymatic) OA. Trivedi, P. Arora et al. Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. Mol. Cell 2005
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002