Rv2936 - daunorubicin-dim-transport ATP-binding protein ABC transporter drrA

Expression: Most Significant Conditions for Rv2936

Protein Domains

Gene Information
Locus	Rv2936
Symbol	drrA
Gene Name	daunorubicin-dim-transport ATP-binding protein ABC transporter drrA
Location	3272214 - 3273209 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:996 bp Protein:332 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35357
Related Genes	DIP0110 jk0559 jk1985 MAP1238c MAV_3250 Mkms_2561 Mkms_2569 Mkms_2571 Mkms_2875 Mkms_3165 ML2352 Mmcs_2516 Mmcs_2524 Mmcs_2526 Mmcs_2831 Mmcs_3105 MSMEG_0487 MSMEG_1217 MSMEG_1218 MSMEG_1234 MSMEG_3254 MSMEG_6766 MT3006 MUL_2014 Mvan_3122
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2936
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2936 Transcript 1
MRNDDMAVVVNGVRKTYGKGKIVALDDVSFKVRRGEVIGLLGPNGAGKTTMVDILSTLTR
PDAGSAIIAGYDVVSEPAGVRRSIMVTGQQVAVDDALSGEQNLVLFGRLWGLSKSAARKR
AAELLEQFSLVHAGKRRVGTYSGGMRRRIDIACGLVVQPQVAFLDEPTTGLDPRSRQAIW
DLVASFKKLGIATLLTTQYLEEADALSDRIILIDHGIIIAEGTANELKHRAGDTFCEIVP
RDLKDLDAIVAALGSLLPEHHRAMLTPDSDRITMPAPDGIRMLVEAARRIDEARIELADI
ALRRPSLDHVFLAMTTDPTESLTHLVSGSAR*

Genomic Sequence

>Rv2936
ATGCGCAACGACGACATGGCGGTGGTGGTTAACGGGGTTCGCAAGACCTACGGCAAGGGC
AAGATTGTGGCCCTCGATGACGTGAGTTTCAAGGTGCGCCGCGGTGAAGTGATCGGGCTG
CTGGGCCCCAACGGGGCCGGCAAGACGACCATGGTGGACATCTTGTCGACGCTGACCCGA
CCGGATGCCGGCTCGGCGATCATCGCTGGCTACGATGTTGTTTCCGAACCGGCCGGTGTA
CGCCGCTCGATCATGGTCACCGGGCAGCAGGTGGCCGTCGACGACGCGCTTTCCGGTGAG
CAGAACCTGGTGTTGTTTGGTCGTCTGTGGGGACTGAGCAAGTCCGCGGCGCGCAAACGC
GCCGCCGAACTGCTCGAGCAATTCAGCCTCGTACATGCCGGAAAGAGGCGGGTGGGCACC
TACTCCGGCGGAATGCGCCGACGAATAGACATCGCGTGCGGATTGGTGGTCCAACCCCAG
GTGGCGTTCTTAGACGAGCCCACCACCGGGCTCGATCCCAGGAGCCGGCAAGCTATTTGG
GATCTGGTGGCCAGCTTCAAGAAGCTGGGCATTGCCACGTTGTTGACCACGCAGTATCTC
GAGGAGGCGGATGCGCTCAGTGACCGCATCATCCTGATCGATCACGGCATAATCATCGCC
GAAGGCACCGCGAATGAACTCAAGCACCGCGCCGGCGACACCTTCTGCGAAATAGTGCCC
CGCGATCTGAAGGATCTGGACGCTATCGTCGCGGCGCTCGGTTCGCTGTTGCCCGAGCAC
CACAGGGCGATGCTGACGCCCGACTCAGACCGCATTACGATGCCGGCGCCTGACGGCATA
CGTATGCTCGTCGAGGCAGCGCGCCGGATCGACGAGGCGAGGATCGAGCTAGCCGATATT
GCGCTGCGCCGACCGTCACTCGATCACGTATTCCTGGCCATGACGACCGATCCCACCGAG
TCTCTGACCCATCTGGTGTCGGGGTCCGCGCGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	Operon Rv2938	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) authors,R. Goude,T. Parish The genetics of cell wall biosynthesis in Mycobacterium tuberculosis. Future Microbiol 2008
Interaction	Operon Rv2938	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) authors,LR. Camacho,D. Ensergueix,E. Perez,B. Gicquel,C. Guilhot Identification of a virulence gene cluster of Mycobacterium tuberculosis by signature-tagged transposon mutagenesis. Mol. Microbiol. 1999
Interaction	Operon Rv2937	active	shahanup86	2012-10-05
	Co-expression BS. Choudhuri, S. Bhakta et al. Overexpression and functional characterization of an ABC (ATP-binding cassette) transporter encoded by the genes drrA and drrB of Mycobacterium tuberculosis. Biochem. J. 2002
Interaction	Operon Rv2937	active	shahanup86	2012-10-05
	Co-expression BS. Choudhuri, S. Bhakta et al. Overexpression and functional characterization of an ABC (ATP-binding cassette) transporter encoded by the genes drrA and drrB of Mycobacterium tuberculosis. Biochem. J. 2002
Interaction	PhysicalInteraction Rv2935	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2935	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2930	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2930	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	RegulatedBy Rv3692	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2745c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0117	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Name	Component of the DrrABC ABC-transporter involved in the translocation of phthiocerol dimycocerosates across the plasma membrane and in drug-resistance; ATP-binding protein	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Other	TBPWY:Other potential DNA repair genes	active	vmizrahi	2012-03-05
Other	TBPWY:Other potential DNA repair genes	active	vmizrahi	2012-03-05
Other	TBPWY:Other potential DNA repair genes	active	vmizrahi	2012-03-05
Other	TBPWY:Other potential DNA repair genes	active	vmizrahi	2012-03-05
	Expression evelated in a number of infection models, including mouse macrophages, mice and clinical lung samples
Symbol	dinF	active	vmizrahi	2012-03-05
	Expression evelated in a number of infection models, including mouse macrophages, mice and clinical lung samples
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Component of the DrrABC ABC-transporter involved in the translocation of phthiocerol dimycocerosates across the plasma membrane and in drug-resistance; ATP-binding protein (phenotypic [mycobacterial and E. coli recombinant strains]) BS. Choudhuri, S. Bhakta et al. Overexpression and functional characterization of an ABC (ATP-binding cassette) transporter encoded by the genes drrA and drrB of Mycobacterium tuberculosis. Biochem. J. 2002
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay M. Jain & JS. Cox Interaction between polyketide synthase and transporter suggests coupled synthesis and export of virulence lipid in M. tuberculosis. PLoS Pathog. 2005