Rv2938 - daunorubicin-dim-transport membrane protein ABC transporter drrC

Expression: Most Significant Conditions for Rv2938

Protein Domains

Gene Information
Locus	Rv2938
Symbol	drrC
Gene Name	daunorubicin-dim-transport membrane protein ABC transporter drrC
Location	3274072 - 3274902 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:831 bp Protein:277 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29764
Related Genes	MAP1236c MAP1237c MAV_3251 MAV_3252 Mkms_3166 Mkms_3167 ML2350 ML2351 Mmcs_3106 Mmcs_3107 MT3007 MT3008 MUL_2012 MUL_2013 nfa41110 nfa41120 Rv2937
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2938
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2938 Transcript 1
MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMV
VLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVH
RASGLISRILANAIRTLVTTLVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVT
TVALYTAQTVVVEGVELVQAIAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAM
GGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH*

Genomic Sequence

>Rv2938
ATGATCACGACGACAAGTCAGGAAATCGAGCTTGCACCCACACGTTTGCCAGGCTCGCAA
AACGCTGCTCGGCTGTTCGTTGCGCAGACCCTTTTGCAGACCAACCGGTTGCTAACTCGA
TGGGCACGTGACTATATCACCGTTATCGGAGCGATCGTGTTACCGATTCTCTTCATGGTG
GTGTTGAACATTGTGCTAGGTAACCTAGCTTATGTCGTAACCCACGACAGCGGGCTCTAC
AGCATTGTTCCGCTGATCGCACTCGGCGCCGCGATCACTGGGTCAACTTTTGTCGCGATC
GACCTGATGCGCGAGCGCTCCTTCGGACTGCTTGCCCGACTGTGGGTGCTGCCCGTGCAC
CGAGCATCGGGCCTGATCTCTCGAATCCTGGCAAACGCGATTCGGACTCTGGTCACCACT
TTAGTGATGCTAGGTACTGGGGTGGTATTGGGTTTCCGGTTTCGACAAGGCCTGATCCCG
AGCCTCATGTGGATTAGTGTCCCGGTGATACTGGGCATCGCAATCGCGGCTATGGTCACT
ACCGTCGCGCTTTACACAGCACAAACCGTTGTTGTCGAAGGCGTTGAGCTGGTGCAAGCA
ATCGCGATCTTCTTCTCCACGGGTTTGGTGCCGCTCAACTCGTATCCAGGCTGGATTCAG
CCGTTCGTCGCCCATCAGCCGGTGAGCTACGCCATCGCGGCGATGCGCGGTTTTGCAATG
GGTGGTCCGGTCCTCTCTCCGATGATCGGGATGCTGGTGTGGACCGCGGGTATCTGCGTC
GTATGCGCCGTACCCTTGGCCATTGGCTACCGACGGGCCAGCACGCATTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2939	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	Operon Rv2936	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) authors,R. Goude,T. Parish The genetics of cell wall biosynthesis in Mycobacterium tuberculosis. Future Microbiol 2008
Interaction	Operon Rv2937	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) authors,R. Goude,T. Parish The genetics of cell wall biosynthesis in Mycobacterium tuberculosis. Future Microbiol 2008
Interaction	Operon Rv2936	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) authors,LR. Camacho,D. Ensergueix,E. Perez,B. Gicquel,C. Guilhot Identification of a virulence gene cluster of Mycobacterium tuberculosis by signature-tagged transposon mutagenesis. Mol. Microbiol. 1999
Interaction	Operon Rv2937	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) authors,LR. Camacho,D. Ensergueix,E. Perez,B. Gicquel,C. Guilhot Identification of a virulence gene cluster of Mycobacterium tuberculosis by signature-tagged transposon mutagenesis. Mol. Microbiol. 1999
Interaction	PhysicalInteraction Rv2935	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2935	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2934	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2933	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2932	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2931	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2930	active	shahanup86	2012-10-05
	Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2930	active	shahanup86	2012-10-05
	Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3692	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2745c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0117	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Name	Component of the DrrABC ABC-transporter involved in the translocation of phthiocerol dimycocerosates across the plasma membrane; integral membrane protein	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Component of the DrrABC ABC-transporter involved in the translocation of phthiocerol dimycocerosates across the plasma membrane; integral membrane protein (phenotypic [mycobacterial recombinant strains]) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay M. Jain & JS. Cox Interaction between polyketide synthase and transporter suggests coupled synthesis and export of virulence lipid in M. tuberculosis. PLoS Pathog. 2005