Rv2986c - histone-like DNA-binding protein hupB

Expression: Most Significant Conditions for Rv2986c

Protein Domains

Gene Information
Locus	Rv2986c
Symbol	hupB
Gene Name	histone-like DNA-binding protein hupB
Location	3343176 - 3343820 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:645 bp Protein:215 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35359
Related Genes	MAP3024c MAV_3836 Mkms_1969 ML1683 Mmcs_1923 MSMEG_2389 MT3064 MUL_1970 Mvan_2137 nfa42100
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2986c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2986c Transcript 1
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVA
RNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPAEGPAVKRGVGASAAKKVAKKAPA
KKATKAAKKAATKAPARKAATKAPAKKAATKAPAKKAVKATKSPAKKVTKAVKKTAVKAS
VRKAATKAPAKKAAAKRPATKAPAKKATARRGRK*

Genomic Sequence

>Rv2986c
ATGAACAAAGCAGAGCTCATTGACGTGCTCACACAGAAATTGGGCTCGGACCGTCGGCAG
GCGACCGCCGCCGTCGAGAATGTCGTTGACACGATTGTGCGTGCGGTACACAAAGGCGAC
AGCGTCACCATTACCGGGTTCGGTGTGTTCGAACAGCGTCGCCGCGCGGCTCGAGTGGCC
CGCAATCCGCGTACCGGCGAGACAGTAAAGGTGAAGCCGACGTCGGTGCCGGCGTTCCGC
CCGGGCGCGCAATTCAAAGCGGTTGTGTCTGGCGCGCAGCGTCTCCCGGCAGAAGGACCC
GCTGTTAAGCGTGGTGTGGGGGCCAGTGCAGCCAAGAAGGTAGCGAAGAAGGCACCTGCC
AAGAAGGCGACAAAGGCCGCCAAGAAGGCGGCGACCAAGGCGCCCGCCAGGAAGGCGGCG
ACCAAGGCGCCCGCCAAGAAAGCGGCGACCAAGGCGCCCGCCAAGAAAGCTGTCAAGGCC
ACGAAGTCACCCGCCAAGAAGGTGACCAAGGCGGTGAAGAAGACCGCGGTCAAGGCATCG
GTGCGTAAGGCGGCGACCAAGGCGCCGGCAAAGAAGGCAGCGGCCAAGCGGCCGGCTACC
AAGGCTCCCGCCAAGAAGGCAACCGCTCGGCGGGGTCGCAAATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Name	DNA-BINDING HISTONE-LIKE PROTEIN, has regulatory effects on mycolyltransferase functions of the Ag85 complex	active	mjackson	2012-10-05
	Regulatory proteins
Other	TBPWY:Alternative excision repair	active	vmizrahi	2012-03-05
	DNA clasping by mycobacterial HU: the C-terminal region of HupB mediates increased specificity of DNA binding
Other	TBPWY:Alternative excision repair	active	vmizrahi	2012-03-05
	Synergy between the N-terminal and C-terminal domains of Mycobacterium tuberculosis HupB is essential for high-affinity binding, DNA supercoiling and inhibition of RecA-promoted strand exchange