Rv3083 - monooxygenase

Expression: Most Significant Conditions for Rv3083

Protein Domains

Gene Information
Locus	Rv3083
Symbol
Gene Name	monooxygenase
Location	3448504 - 3449991 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1488 bp Protein:496 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	25762
Related Genes	MAP4062c MAV_4576 Mkms_1582 Mmcs_1558 MSMEG_2038 MT0591 MT3168 MUL_4352 Mvan_1867 nfa12780 Rv0565c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3083
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3083 Transcript 1
MNQHFDVLIIGAGLSGIGTACHVTAEFPDKTIALLERRERLGGTWDLFRYPGVRSDSDMF
TFGYKFRPWRDVKVLADGASIRQYIADTATEFGVDEKIHYGLKVNTAEWSSRQCRWTVAG
VHEATGETRTYTCDYLISCTGYYNYDAGYLPDFPGVHRFGGRCVHPQHWPEDLDYSGKKV
VVIGSGATAVTLVPAMAGSNPGSAAHVTMLQRSPSYIFSLPAVDKISEVLGRFLPDRWVY
EFGRRRNIAIQRKLYQACRRWPKLMRRLLLWEVRRRLGRSVDMSNFTPNYLPWDERLCAV
PNGDLFKTLASGAASVVTDQIETFTEKGILCKSGREIEADIIVTATGLNIQMLGGMRLIV
DGAEYQLPEKMTYKGVLLENAPNLAWIIGYTNASWTLKSDIAGAYLCRLLRHMADNGYTV
ATPRDAQDCALDVGMFDQLNSGYVKRGQDIMPRQGSKHPWRVLMHYEKDAKILLEDPIDD
GVLHFAAAAQDHAAA*

Genomic Sequence

>Rv3083
ATGAACCAGCATTTCGACGTCCTGATCATCGGCGCCGGCCTATCCGGCATCGGGACGGCC
TGTCACGTGACGGCCGAGTTCCCCGACAAGACAATCGCCCTCCTGGAACGACGGGAGCGC
CTGGGCGGCACCTGGGACTTGTTCCGCTACCCGGGAGTTCGTTCGGACTCCGACATGTTC
ACCTTCGGCTACAAGTTCCGCCCGTGGCGCGACGTGAAGGTGCTCGCCGACGGCGCGTCG
ATCCGGCAGTACATCGCCGACACCGCCACGGAGTTCGGCGTCGACGAGAAGATTCACTAC
GGCCTGAAGGTCAACACCGCCGAGTGGTCGAGCCGGCAGTGCCGTTGGACCGTCGCGGGC
GTGCACGAGGCGACCGGCGAAACCCGGACCTACACCTGCGATTACCTCATCAGCTGCACC
GGCTACTACAACTACGACGCGGGTTATCTGCCGGACTTCCCCGGCGTGCACCGGTTCGGC
GGCCGGTGCGTGCACCCGCAGCACTGGCCCGAAGACCTCGATTATTCCGGCAAGAAGGTC
GTCGTCATCGGCAGCGGCGCAACGGCGGTCACTTTGGTTCCGGCGATGGCCGGCTCCAAC
CCCGGCAGTGCCGCGCACGTGACGATGCTGCAGCGATCCCCGTCGTACATCTTCTCGCTG
CCGGCGGTCGACAAGATCTCCGAAGTCCTGGGCCGCTTCCTGCCGGATCGCTGGGTCTAC
GAGTTTGGCCGCAGGCGCAACATCGCCATCCAGCGAAAGCTCTACCAGGCCTGCCGGCGC
TGGCCCAAGCTGATGCGGCGATTGCTGCTGTGGGAGGTACGACGCCGCCTCGGCCGCTCC
GTGGACATGAGCAACTTCACCCCGAACTACCTGCCGTGGGACGAGCGGTTGTGCGCCGTG
CCCAACGGCGATCTGTTTAAGACGCTGGCCTCGGGCGCGGCGTCGGTGGTGACCGATCAG
ATCGAGACCTTCACCGAGAAGGGCATCCTGTGCAAGTCCGGCCGGGAGATCGAGGCCGAC
ATCATCGTCACCGCGACCGGTCTGAACATCCAGATGCTGGGCGGGATGCGACTCATCGTG
GACGGCGCCGAATACCAGCTGCCGGAGAAGATGACCTATAAGGGTGTGCTGCTGGAAAAC
GCCCCCAATCTGGCCTGGATCATCGGCTACACCAACGCGTCATGGACCCTGAAGTCCGAC
ATCGCCGGCGCCTACCTGTGCCGGCTGCTGCGGCACATGGCCGACAACGGCTACACGGTG
GCAACGCCGCGCGATGCGCAGGACTGCGCGCTGGACGTTGGCATGTTCGACCAGCTGAAC
TCCGGCTATGTGAAGCGCGGCCAGGACATCATGCCGCGCCAGGGCTCCAAGCATCCGTGG
AGGGTGCTCATGCACTACGAGAAGGACGCCAAGATCCTGCTCGAAGACCCCATCGATGAC
GGCGTGCTGCACTTCGCCGCAGCGGCCCAAGACCACGCGGCGGCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3088	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3084	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3089	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3088	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3087	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3086	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3084	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Activation Rv3080c	active	priyadarshinipriyanka2001	2012-10-05
	Structural Analysis P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Activation Rv3080c	active	priyadarshinipriyanka2001	2012-10-05
	Spectrophotometric P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Regulatory Rv3082c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3082c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3082c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3082c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3082c	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	RegulatedBy Rv3082c	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003