Rv3137 - monophosphatase

Expression: Most Significant Conditions for Rv3137

Protein Domains

Gene Information
Locus	Rv3137
Symbol
Gene Name	monophosphatase
Location	3503393 - 3504175 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:783 bp Protein:261 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34185
Related Genes	CE0809 CE0810 cg0910 cg0911 DIP0744 DIP0745 jk0451 jk0452 MAP3187 MAV_4017 Mkms_1629 ML0662 Mmcs_1605 MSMEG_2083 MT3224 MUL_2430 Mvan_1908 nfa44910 PPA0913 SAV1937
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3137
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3137 Transcript 1
MSHDDLMLALALADRADELTRVRFGALDLRIDTKPDLTPVTDADRAVESDVRQTLGRDRP
GDGVLGEEFGGSTTFTGRQWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSVGVVSAPAL
QRRWWAARGRGAFASVDGARPHRLSVSSVAELHSASLSFSSLSGWARPGLRERFIGLTDT
VWRVRAYGDFLSYCLVAEGAVDIAAEPQVSVWDLAALDIVVREAGGRLTSLDGVAGPHGG
SAVATNGLLHDEVLTRLNAG*

Genomic Sequence

>Rv3137
GTGAGCCACGACGATCTAATGCTTGCGCTGGCTCTGGCCGACCGTGCGGACGAATTGACG
CGGGTCCGGTTCGGGGCGCTCGATCTGCGCATCGACACCAAACCGGATTTGACGCCGGTG
ACCGACGCCGATCGGGCGGTCGAATCCGACGTGCGCCAGACGCTGGGCCGCGACCGGCCC
GGCGACGGCGTCTTGGGCGAGGAGTTCGGCGGATCAACGACCTTCACCGGACGGCAGTGG
ATCGTAGACCCGATCGACGGCACCAAAAACTTTGTGCGCGGGGTGCCGGTGTGGGCCAGT
TTGATCGCGCTGCTTGAAGATGGCGTCCCGTCGGTCGGTGTGGTGAGTGCGCCGGCGCTG
CAACGGCGGTGGTGGGCGGCACGCGGCCGGGGCGCGTTCGCATCCGTCGATGGTGCGCGT
CCACACCGGCTGTCGGTTTCCTCTGTGGCAGAGCTGCATTCGGCGAGCTTGTCGTTTTCC
AGTCTGTCCGGGTGGGCGCGGCCGGGTCTACGTGAACGCTTCATCGGGTTGACCGATACC
GTGTGGCGCGTGCGTGCTTACGGCGACTTTCTGTCTTACTGCCTGGTGGCCGAGGGCGCC
GTCGATATTGCCGCCGAACCGCAAGTGTCGGTATGGGATCTGGCGGCACTGGACATCGTG
GTGCGTGAGGCGGGCGGGCGGCTCACCAGCCTGGACGGCGTCGCCGGCCCACACGGGGGC
AGCGCCGTTGCAACCAACGGTCTGTTGCACGACGAGGTGCTGACACGGCTCAACGCCGGG
TAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006