Rv3221A - anti-sigma factor

Expression: Most Significant Conditions for Rv3221A

Protein Domains

Gene Information
Locus	Rv3221A
Symbol
Gene Name	anti-sigma factor
Location	3598051 - 3598356 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:306 bp Protein:102 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	1311
Related Genes	Acel_0539 cg0877 DIP0710 jk1622 MAP3323c Mkms_1398 Mmcs_1380 MSMEG_1915 MT3318 MUL_2544 Mvan_1779 nfa45830 PPA2382 SAV3037
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3221A
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3221A Transcript 1
MSENCGPTDAHADHDDSHGGMGCAEVIAEVWTLLDGECTPETRERLRRHLEACPGCLRHY
GLEERIKALIGTKCRGDRAPEGLRERLRLEIRRTTIIRGGP*

Genomic Sequence

>Rv3221A
GTGAGCGAAAATTGCGGTCCGACCGATGCGCACGCGGACCACGACGATTCCCACGGCGGC
ATGGGTTGCGCGGAAGTGATCGCCGAGGTGTGGACCCTGCTTGACGGTGAATGCACCCCG
GAAACCCGCGAGAGGCTGCGGCGACACCTCGAGGCCTGCCCGGGGTGCCTGAGGCATTAC
GGGCTCGAGGAACGGATCAAGGCGTTGATCGGGACCAAGTGCCGAGGCGACAGGGCCCCC
GAGGGCTTGCGGGAGCGTCTTCGGCTAGAGATCCGCCGGACCACCATCATCCGTGGAGGG
CCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
Interaction	Regulatory Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Regulatory Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
Interaction	Regulatory Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Regulatory Rv3223c	active	akankshajain.21	2012-10-05
	Affinity Purifiaction (Physical Interaction) EH. Jeong, YM. Son et al. RshA mimetic peptides inhibiting the transcription driven by a Mycobacterium tuberculosis sigma factor SigH. Biochem. Biophys. Res. Commun. 2006
Interaction	Signaling Rv0014c	active	jgalag	2012-10-05
	Affinity purification (Physical interaction) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008