Rv3223c - alternative RNA polymerase sigma factor sigH

Expression: Most Significant Conditions for Rv3223c

Protein Domains

Gene Information
Locus	Rv3223c
Symbol	sigH
Gene Name	alternative RNA polymerase sigma factor sigH
Location	3598901 - 3599551 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:651 bp Protein:217 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	34851
Related Genes	CE0782 cg0876 DIP0709 jk1623 MAP3324c MAV_4171 Mkms_1397 Mmcs_1379 MSMEG_1914 MT3320 MUL_2545 Mvan_1778 nfa45840
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3223c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3223c Transcript 1
MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQE
TMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEH
SSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTV
MSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS*

Genomic Sequence

>Rv3223c
ATGGCCGACATCGATGGTGTAACCGGTTCGGCGGGTCTGCAGCCTGGGCCGTCTGAGGAG
ACAGACGAGGAGTTGACCGCGCGTTTCGAGCGCGACGCGATTCCCCTGTTGGACCAGCTG
TACGGCGGTGCGCTGCGGATGACGCGCAATCCGGCCGACGCCGAGGACTTGCTCCAGGAG
ACGATGGTGAAGGCCTATGCGGGATTTCGTTCGTTCCGGCACGGTACCAATCTCAAGGCC
TGGCTCTACCGGATACTGACCAACACCTACATCAACAGCTATCGCAAGAAACAGCGGCAA
CCGGCGGAGTATCCGACCGAGCAGATCACCGATTGGCAACTGGCGTCCAACGCCGAGCAT
TCCTCGACCGGGCTGCGCTCGGCTGAAGTCGAAGCGTTAGAAGCGTTGCCGGACACCGAG
ATCAAAGAGGCGCTGCAGGCATTGCCGGAAGAGTTCCGGATGGCGGTCTACTACGCCGAT
GTCGAAGGTTTCCCCTACAAGGAGATCGCCGAGATCATGGATACTCCGATCGGCACCGTG
ATGTCGAGGCTTCATCGCGGCCGACGTCAGTTGCGCGGTCTTTTAGCCGATGTGGCCAGG
GATCGGGGGTTTGCCAGGGGCGAGCAGGCGCACGAGGGGGTGTCGTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3753c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Transcription Rv3753c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Transcription Rv3692	active	aparna.vchalam	2012-10-05
	S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Transcription Rv3692	active	priyadarshinipriyanka2001	2012-10-05
	S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Regulatory Rv0014c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
Interaction	Regulatory Rv3221A	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
Interaction	Regulatory Rv0014c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Regulatory Rv3221A	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Regulatory Rv0014c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
Interaction	Regulatory Rv3221A	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Song, SL. Dove et al. RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH. Mol. Microbiol. 2003
Interaction	Regulatory Rv0014c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Regulatory Rv3221A	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3914	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv1471	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv0142	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv1221	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3914	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv1471	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv0142	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv1221	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3914	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv1471	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv0142	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv1221	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3914	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv1471	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv0142	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv1221	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3914	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv1471	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv0142	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv1221	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3914	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv1471	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv0142	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv1221	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3913	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv2466c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Regulatory Rv3221A	active	akankshajain.21	2012-10-05
	Affinity Purifiaction (Physical Interaction) EH. Jeong, YM. Son et al. RshA mimetic peptides inhibiting the transcription driven by a Mycobacterium tuberculosis sigma factor SigH. Biochem. Biophys. Res. Commun. 2006
Interaction	Regulatory Rv3198A	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Regulatory Rv2466c	active	vmevada102	2012-10-05
	authors,M. Alonso-Hearn,D. Patel,L. Danelishvili,L. Meunier-Goddik,LE. Bermudez The Mycobacterium avium subsp. paratuberculosis MAP3464 gene encodes an oxidoreductase involved in invasion of bovine epithelial cells through the activation of host cell Cdc42. Infect. Immun. 2008
Interaction	Regulatory Rv2466c	active	vmevada102	2012-10-05
	S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Regulatory Rv2453c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression. Mol. Microbiol. 2002
Interaction	Transcription Rv2442c	active	salluamity1	2012-10-05
	Co expression Analysis S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Regulatory Rv2050	active	shahanup86	2012-10-05
	R. Provvedi, F. Boldrin et al. Global transcriptional response to vancomycin in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Regulatory Rv1921c	active	kaveri.verma	2012-10-05
	qPCR authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	Regulatory Rv1921c	active	kaveri.verma	2012-10-05
	qPCR S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Regulatory Rv1528c	active	sharanya123	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression. Mol. Microbiol. 2002
Interaction	Regulatory Rv1528c	active	sharanya123	2012-10-05
	Co-expression (Functional linkage) K. Bhatt, SS. Gurcha et al. Two polyketide-synthase-associated acyltransferases are required for sulfolipid biosynthesis in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2007
Interaction	Regulatory Rv1528c	active	sharanya123	2012-10-05
	Co-expression (Functional linkage) G. Etienne, W. Malaga et al. Identification of the polyketide synthase involved in the biosynthesis of the surface-exposed lipooligosaccharides in mycobacteria. J. Bacteriol. 2009
Interaction	Regulatory Rv1338	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression. Mol. Microbiol. 2002
Interaction	Regulatory Rv1336	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression. Mol. Microbiol. 2002
Interaction	Regulatory Rv1223	active	harsharohiratruefriend	2012-10-05
	Mutant studies MJ. White, H. He et al. PepD participates in the mycobacterial stress response mediated through MprAB and SigE. J. Bacteriol. 2010
Interaction	Regulatory Rv1123c	active	anshula.arora1990	2012-10-05
	aPCR S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Transcription Rv1072	active	sourish10	2012-10-05
	Co-occurrence (Functional linkage) authors,KT. Schricker [Prevention and therapy of disorders of pulmonary microcirculation]. Klin Anasthesiol Intensivther 1979
Interaction	Transcription Rv1072	active	sourish10	2012-10-05
	Co-occurrence (Functional linkage) authors,SK. Jain,SM. Hernandez-Abanto,QJ. Cheng,P. Singh,LH. Ly,LG. Klinkenberg,NE. Morrison,PJ. Converse,E. Nuermberger,J. Grosset,DN. McMurray,PC. Karakousis,G. Lamichhane,WR. Bishai Accelerated detection of Mycobacterium tuberculosis genes essential for bacterial survival in guinea pigs, compared with mice. J. Infect. Dis. 2007
Interaction	Regulatory Rv1019	active	ashwinigbhat	2012-10-05
	Mutant Studies S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Transcription Rv0886	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Regulatory Rv0384c	active	manish.srcp	2012-10-05
	Co-expression (Functional linkage) PA. Fontán,MI. Voskuil,M. Gomez,D. Tan,M. Pardini,R. Manganelli,L. Fattorini,GK. Schoolnik,I. Smith The Mycobacterium tuberculosis sigma factor sigmaB is required for full response to cell envelope stress and hypoxia in vitro, but it is dispensable for in vivo growth. J. Bacteriol. 2009
Interaction	Regulatory Rv0384c	active	manish.srcp	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Regulatory Rv0303	active	sumaavasthi	2012-10-05
	Co-expression (Functional linkage) S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009
Interaction	Regulatory Rv0182c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Regulatory Rv0142	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression. Mol. Microbiol. 2002
Interaction	Regulatory Rv0142	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Regulatory Rv0141c	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression. Mol. Microbiol. 2002
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Regulates Rv3913	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3463	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3223c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3223c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3206c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3055	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3054c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2710	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2703	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2700	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2699c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2467	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2466c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2308	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1646	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1645c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1535	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1471	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1334	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1223	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1221	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1072	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0991c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0385	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0384c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0355c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0350	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0252	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0251c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0142	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008