Rv3246c - two component system transcriptional regulator mtrA

Expression: Most Significant Conditions for Rv3246c

Protein Domains

Gene Information
Locus	Rv3246c
Symbol	mtrA
Gene Name	two component system transcriptional regulator mtrA
Location	3626663 - 3627349 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:687 bp Protein:229 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35369
Related Genes	Acel_1765 CE0769 cg0862 DIP0694 jk1635 MAP3360c MAV_4209 Mkms_1365 ML0773 Mmcs_1347 MSMEG_1874 MT3344 MUL_2582 Mvan_1752 nfa46110 SAV5063
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3246c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3246c Transcript 1
MDTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLP
GMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARL
RRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLE
QVWGYRHPADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP*

Genomic Sequence

>Rv3246c
ATGGACACCATGAGGCAAAGGATTTTGGTCGTTGACGACGACGCTTCGTTGGCTGAGATG
CTCACCATCGTGCTGCGGGGGGAAGGCTTCGACACCGCGGTCATCGGCGACGGTACTCAG
GCTCTGACCGCGGTGCGCGAGCTGCGCCCCGATCTGGTGTTATTGGATTTGATGCTGCCC
GGTATGAACGGCATCGACGTGTGCCGGGTGTTGCGCGCCGATTCCGGTGTTCCGATCGTG
ATGCTCACCGCAAAGACCGACACCGTGGATGTGGTGCTGGGTCTGGAGTCGGGCGCCGAC
GACTACATCATGAAGCCGTTCAAGCCCAAGGAGCTGGTTGCGCGGGTGCGGGCGCGGCTG
CGCCGCAACGACGACGAACCCGCCGAGATGCTGTCCATCGCCGACGTAGAAATCGACGTA
CCGGCGCACAAGGTCACTCGCAACGGTGAGCAGATCTCGTTGACACCGCTGGAATTCGAC
CTGTTGGTCGCATTGGCGCGCAAGCCGCGCCAGGTGTTTACTCGTGATGTGCTGCTCGAA
CAGGTATGGGGTTACCGGCACCCAGCCGATACCAGGCTGGTGAACGTGCATGTCCAGCGT
CTGCGGGCCAAGGTCGAAAAGGATCCCGAGAACCCGACTGTGGTGCTGACCGTTCGAGGA
GTGGGGTACAAGGCCGGACCTCCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv2069	active	sourish10	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Signaling Rv3245c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) KK. Singh, X. Zhang et al. Antigens of Mycobacterium tuberculosis expressed during preclinical tuberculosis: serological immunodominance of proteins with repetitive amino acid sequences. Infect. Immun. 2001
Interaction	Signaling Rv3245c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) TC. Zahrt & V. Deretic An essential two-component signal transduction system in Mycobacterium tuberculosis. J. Bacteriol. 2000
Interaction	Signaling Rv3245c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,GA. Cangelosi,JS. Do,R. Freeman,JG. Bennett,M. Semret,MA. Behr The two-component regulatory system mtrAB is required for morphotypic multidrug resistance in Mycobacterium avium. Antimicrob. Agents Chemother. 2006
Interaction	Signaling Rv3245c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) KK. Singh, X. Zhang et al. Antigens of Mycobacterium tuberculosis expressed during preclinical tuberculosis: serological immunodominance of proteins with repetitive amino acid sequences. Infect. Immun. 2001
Interaction	Signaling Rv3245c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) TC. Zahrt & V. Deretic An essential two-component signal transduction system in Mycobacterium tuberculosis. J. Bacteriol. 2000
Interaction	Signaling Rv3245c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,GA. Cangelosi,JS. Do,R. Freeman,JG. Bennett,M. Semret,MA. Behr The two-component regulatory system mtrAB is required for morphotypic multidrug resistance in Mycobacterium avium. Antimicrob. Agents Chemother. 2006
Interaction	Regulatory Rv3244c	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,PA. Hoskisson,MI. Hutchings MtrAB-LpqB: a conserved three-component system in actinobacteria? Trends Microbiol. 2006
Interaction	Regulatory Rv3244c	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) N. Möker, M. Brocker et al. Deletion of the genes encoding the MtrA-MtrB two-component system of Corynebacterium glutamicum has a strong influence on cell morphology, antibiotics susceptibility and expression of genes involved in osmoprotection. Mol. Microbiol. 2004
Interaction	Regulatory Rv2069	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv2069	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004