Rv3251c - rubredoxin rubA

Expression: Most Significant Conditions for Rv3251c

Protein Domains

Gene Information
Locus	Rv3251c
Symbol	rubA
Gene Name	rubredoxin rubA
Location	3630571 - 3630738 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:168 bp Protein:56 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	13948
Related Genes	MAV_4213 MAV_4214 Mkms_1351 Mkms_1352 Mmcs_1334 MSMEG_1840 MSMEG_1841 MT3348 MT3349 MUL_2594 MUL_2595 Mvan_1743 Mvan_1744 nfa46160 nfa46170 Rv3250c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3251c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3251c Transcript 1
MAAYRCPVCDYVYDEANGDAREGFPAGTGWDQIPDDWCCPDCAVREKVDFEKIGG*

Genomic Sequence

>Rv3251c
ATGGCCGCCTACCGGTGCCCGGTCTGCGACTACGTCTACGACGAGGCCAACGGTGATGCC
AGGGAAGGCTTCCCAGCCGGCACAGGCTGGGATCAAATTCCCGACGACTGGTGCTGCCCG
GACTGCGCGGTGCGCGAGAAGGTCGATTTCGAAAAGATAGGAGGGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3250c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,W. Geissdörfer,RG. Kok,A. Ratajczak,KJ. Hellingwerf,W. Hillen The genes rubA and rubB for alkane degradation in Acinetobacter sp. strain ADP1 are in an operon with estB, encoding an esterase, and oxyR. J. Bacteriol. 1999
Interaction	Transcription Rv3250c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,W. Geissdörfer,RG. Kok,A. Ratajczak,KJ. Hellingwerf,W. Hillen The genes rubA and rubB for alkane degradation in Acinetobacter sp. strain ADP1 are in an operon with estB, encoding an esterase, and oxyR. J. Bacteriol. 1999
Interaction	RegulatedBy Rv3681c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0818	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009