Rv3287c - anti-sigma factor rsbW

Expression: Most Significant Conditions for Rv3287c

Protein Domains

Gene Information
Locus	Rv3287c
Symbol	rsbW
Gene Name	anti-sigma factor rsbW
Location	3668951 - 3669388 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:438 bp Protein:146 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	18945
Related Genes	Acel_0565 MAP3407c MAV_4258 Mkms_1297 Mmcs_1280 MSMEG_1787 MSMEG_1803 MT3386 MUL_2641 Mvan_1659 nfa36040 SAV3012
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3287c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3287c Transcript 1
MADSDLPTKGRQRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEV
CTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFH
DGRQPDVAGSVFGITLTARRAASSR*

Genomic Sequence

>Rv3287c
ATGGCCGACTCGGATTTACCCACCAAGGGGCGCCAACGCGGTGTCCGCGCCGTCGAGCTG
AACGTTGCTGCCCGCCTGGAGAACCTGGCGCTGCTGCGCACCCTGGTCGGCGCCATCGGC
ACCTTCGAGGACCTGGATTTCGACGCCGTGGCCGACCTGAGGTTGGCGGTGGACGAGGTG
TGCACCCGGTTGATTCGCTCGGCCTTGCCGGATGCCACCCTGCGCCTGGTGGTCGATCCG
CGAAAAGACGAAGTTGTGGTGGAGGCTTCTGCTGCCTGCGACACCCACGACGTGGTGGCA
CCGGGCAGCTTTAGCTGGCATGTCCTGACCGCGCTGGCCGACGACGTCCAGACCTTCCAC
GACGGTCGCCAGCCCGATGTAGCCGGCAGTGTCTTCGGCATCACGTTGACCGCCCGACGG
GCGGCATCCAGCAGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3687c	active	akankshajain.21	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Structural Analysis authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Structural Analysis authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	InhibitedBy Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	InhibitedBy Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Inhibits Rv1365c	active	vijayachitra	2012-10-05
	Spectrophotometric authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Inhibits Rv3286c	active	vijayachitra	2012-10-05
	Spectrophotometric authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Signaling Rv2638	active	priya.bdu07	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Signaling Rv1904	active	kaveri.verma	2012-10-05
	yeast two-hybrid system(functional linkage) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1904	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1365c	active	prabhakarsmail	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1365c	active	akankshajain.21	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1364c	active	swetha.r	2012-10-05
	authors,MS. Li,SJ. Waddell,IM. Monahan,JA. Mangan,SL. Martin,MJ. Everett,PD. Butcher Increased transcription of a potential sigma factor regulatory gene Rv1364c in Mycobacterium bovis BCG while residing in macrophages indicates use of alternative promoters. FEMS Microbiol. Lett. 2004
Interaction	Regulatory Rv1364c	active	swetha.r	2012-10-05
	authors,RK. Jaiswal,G. Manjeera,B. Gopal Role of a PAS sensor domain in the Mycobacterium tuberculosis transcription regulator Rv1364c. Biochemical and biophysical research communications 2010
Interaction	Regulatory Rv1364c	active	swetha.r	2012-10-05
	P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv0516c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007