Rv3361c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3361c

Protein Domains

Gene Information
Locus	Rv3361c
Symbol
Gene Name	conserved hypothetical protein
Location	3773016 - 3773567 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:552 bp Protein:184 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	3875
Related Genes	MAP3468c MAV_4327 Mkms_1210 Mmcs_1193 MSMEG_1641 MT3469 MUL_2846 Mvan_1540
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3361c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3361c Transcript 1
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLW
HSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLR
KCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCL
AGG*

Genomic Sequence

>Rv3361c
TTGCAGCAGTGGGTTGATTGCGAATTCACCGGTCGAGACTTCCGCGACGAGGACCTTAGC
CGCCTGCACACCGAACGGGCGATGTTCAGCGAATGCGATTTCAGCGGCGTGAATCTGGCC
GAGTCACAACACCGAGGGTCGGCGTTTCGTAATTGCACCTTCGAACGGACGACACTGTGG
CACAGCACATTTGCCCAGTGCAGCATGTTGGGCTCGGTCTTCGTGGCTTGCCGGCTGCGG
CCGCTGACGTTGGACGACGTGGATTTCACGCTCGCCGTGCTCGGCGGAAATGATCTGCGT
GGTCTCAACTTGACCGGCTGCCGGTTGCGAGAGACCAGCCTGGTGGATACCGACTTGCGC
AAGTGCGTGCTGCGCGGCGCCGACCTCAGTGGTGCCCGTACCACGGGCGCCCGGCTGGAT
GACGCCGACTTGCGGGGCGCGACCGTGGACCCGGTATTGTGGCGGACCGCGTCGTTGGTG
GGTGCGCGTGTCGACGTCGACCAAGCCGTGGCCTTTGCGGCGGCGCACGGGCTGTGCTTG
GCAGGGGGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv0005	active	vashishtrv	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0006	active	vashishtrv	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0005	active	vashishtrv	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0006	active	vashishtrv	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0005	active	vashishtrv	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0006	active	vashishtrv	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0005	active	vashishtrv	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0006	active	vashishtrv	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0005	active	shahanup86	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0006	active	shahanup86	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0005	active	shahanup86	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0006	active	shahanup86	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0005	active	shahanup86	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0006	active	shahanup86	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0005	active	shahanup86	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0006	active	shahanup86	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0005	active	vashishtrv	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0006	active	vashishtrv	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0005	active	vashishtrv	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0006	active	vashishtrv	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0005	active	vashishtrv	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0006	active	vashishtrv	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0005	active	vashishtrv	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0006	active	vashishtrv	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0005	active	shahanup86	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0006	active	shahanup86	2012-10-05
	Structural Analysis A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0005	active	shahanup86	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0006	active	shahanup86	2012-10-05
	Structural Analysis authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0005	active	shahanup86	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0006	active	shahanup86	2012-10-05
	Spectrophotometric A. Mérens, S. Matrat et al. The pentapeptide Repeat Proteins MtMfpA and QnrB4 Exhibit Opposite Effects on DNA Gyrase Catalytic Reactions and on the Ternary Gyrase-DNA-Quinolone Complex. J. Bacteriol. 2008
Interaction	Inhibition Rv0005	active	shahanup86	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005
Interaction	Inhibition Rv0006	active	shahanup86	2012-10-05
	Spectrophotometric authors,SS. Hegde,MW. Vetting,SL. Roderick,LA. Mitchenall,A. Maxwell,HE. Takiff,JS. Blanchard A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA. Science 2005